SPIB Antibody - C-terminal region (ARP31422_P050)

Data Sheet
 
Product Number ARP31422_P050
Product Page www.avivasysbio.com/spib-antibody-c-terminal-region-arp31422-p050.html
Name SPIB Antibody - C-terminal region (ARP31422_P050)
Protein Size (# AA) 177 amino acids
Molecular Weight 19kDa
NCBI Gene Id 6689
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name Spi-B transcription factor (Spi-1/PU.1 related)
Alias Symbols SPI-B
Peptide Sequence Synthetic peptide located within the following region: GQQKGNRKRMTYQKLARALRNYAKTGEIRKVKRKLTYQFDSALLPAVRRA
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Geng,C.D. (2005) J. Biol. Chem. 280 (52), 43264-43271
Description of Target SPI1 (MIM 165170) and SPIB are members of a subfamily of ETS (see ETS1; MIM 164720) transcription factors. ETS proteins share a conserved ETS domain that mediates specific DNA binding. SPIB and SPI1 bind to a purine-rich sequence, the PU box (5-prime-GAGGAA-3-prime).
Protein Interactions TMEM37; SSB; GATA1; IRF4; MAPK3; MAPK8; CREBBP; TBP; CEBPB; RB1; SPI1; JUN; CSNK2A2; CSNK2A1; SPIB; E2F4; E2F3; E2F2; E2F1;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-SPIB (ARP31422_P050) antibody
Blocking Peptide For anti-SPIB (ARP31422_P050) antibody is Catalog # AAP31422 (Previous Catalog # AAPP03080)
Immunogen The immunogen is a synthetic peptide directed towards the C terminal region of human SPIB
Uniprot ID Q01892
Protein Name Transcription factor Spi-B
Sample Type Confirmation

SPIB is supported by BioGPS gene expression data to be expressed in Daudi

Protein Accession # NP_003112
Purification Affinity Purified
Nucleotide Accession # NM_003121
Tested Species Reactivity Human
Gene Symbol SPIB
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100%
Image 1
Human spleen
WB Suggested Anti-SPIB Antibody Titration: 3 ug/ml
ELISA Titer: 1:62500
Positive Control: spleen tissue lysateSPIB is supported by RNA-seq data to be expressed in spleen
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com