MSX1 Antibody - middle region (ARP31396_T100)

Data Sheet
 
Product Number ARP31396_T100
Product Page www.avivasysbio.com/msx1-antibody-middle-region-arp31396-t100.html
Name MSX1 Antibody - middle region (ARP31396_T100)
Protein Size (# AA) 297 amino acids
Molecular Weight 31kDa
NCBI Gene Id 4487
Host Rabbit
Clonality Polyclonal
Concentration 1.0 mg/ml
Gene Full Name Msh homeobox 1
Alias Symbols HOX7, HYD1, ECTD3, STHAG1
Peptide Sequence Synthetic peptide located within the following region: SLGAPDAPSSPRPLGHFSVGGLLKLPEDALVKAESPEKPERTPWMQSPRF
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Djousse,L., et al., (2004) Neurogenetics 5 (2), 109-114
Description of Target Slightly proximal to the Huntington disease locus, the human MSX1 gene is deleted in patients with Wolf-Hirschhorn syndrome. This gene is also called HOX7. The Msx family of vertebrate HOX genes was originally isolated by homology to the Drosophila msh (muscle segment homeo box) gene. This is a candidate gene for human cleft palate.
Protein Interactions MED19; NMNAT1; ING4; UBC; TLE2; PIAS1; PAX3; TLE4; LHX2; SUMO2; RGS7; SUMO1; TLE1; AES; CREBBP; TBP; TAF1; TP53; SP1; PAX9; POU2F1; MSX1; MSX2; HOXC8; DLX5; DLX2;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-MSX1 (ARP31396_T100) antibody
Blocking Peptide For anti-MSX1 (ARP31396_T100) antibody is Catalog # AAP31396 (Previous Catalog # AAPP02153)
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human MSX1
Uniprot ID P28360
Protein Name Homeobox protein MSX-1
Publications

Mizokami, Y. et al. Expression of MSX1 in human normal pituitaries and pituitary adenomas. Endocr. Pathol. 19, 54-61 (2008). 18379900

Protein Accession # NP_002439
Purification Protein A purified
Nucleotide Accession # NM_002448
Tested Species Reactivity Human
Gene Symbol MSX1
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse
Application IHC, WB
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 86%; Rat: 100%
Image 1
Human Kidney
WB Suggested Anti-MSX1 Antibody Titration: 2.0ug/ml
ELISA Titer: 1:62500
Positive Control: Human Kidney
Image 2
Human Muscle
HumanMuscle
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com