HOXD4 Antibody - C-terminal region (ARP31391_P050)

• Product Number: ARP31391_P050
• Name: HOXD4 Antibody - C-terminal region (ARP31391_P050)
• Protein Size (# AA): 255 amino acids
• Molecular Weight: 28kDa
• NCBI Gene Id: 3233
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Gene Full Name: Homeobox D4
• Alias Symbols: HOX4, HOX4B, HHO.C13, HOX-5.1, Hox-4.2
• Peptide Sequence: Synthetic peptide located within the following region: RMKWKKDHKLPNTKGRSSSSSSSSSCSSSVAPSQHLQPMAKDHHTDLTTL
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reference: Kosaki,K., (2002) Teratology 65 (2), 50-62
• Description of Target: HOXD4 belongs to the homeobox family of genes. The homeobox genes encode a highly conserved family of transcription factors that play an important role in morphogenesis in all multicellular organisms. Mammals possess four similar homeobox gene clusters, HOXA, HOXB, HOXC and HOXD, located on different chromosomes, consisting of 9 to 11 genes arranged in tandem. This gene is one of several homeobox HOXD genes located at 2q31-2q37 chromosome regions. Deletions that removed the entire HOXD gene cluster or 5' end of this cluster have been associated with severe limb and genital abnormalities. The protein encoded by this gene may play a role in determining positional values in developing limb buds. Alternatively spliced variants have been described but their full length nature has not been determined.This gene belongs to the homeobox family of genes. The homeobox genes encode a highly conserved family of transcription factors that play an important role in morphogenesis in all multicellular organisms. Mammals possess four similar homeobox gene clusters, HOXA, HOXB, HOXC and HOXD, located on different chromosomes, consisting of 9 to 11 genes arranged in tandem. This gene is one of several homeobox HOXD genes located at 2q31-2q37 chromosome regions. Deletions that removed the entire HOXD gene cluster or 5' end of this cluster have been associated with severe limb and genital abnormalities. The protein encoded by this gene may play a role in determining positional values in developing limb buds. Alternatively spliced variants have been described but their full length nature has not been determined.
• Protein Interactions: EP300; CREBBP; TIGD4; ASB8; ZSCAN18; CNOT7; ZBTB32; RNPS1; ZMYND11; HOXB13; DEDD; SNAI1; RXRG; HNRNPAB; ETV4; PBX1; HIPK1; MEIS1; XRCC6;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Blocking Peptide: For anti-HOXD4 (ARP31391_P050) antibody is Catalog # AAP31391 (Previous Catalog # AAPP02146)
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human HOXD4
• Uniprot ID: P09016
• Protein Name: Homeobox protein Hox-D4
• Protein Accession #: NP_055436
• Purification: Affinity Purified
• Nucleotide Accession #: NM_014621
• Tested Species Reactivity: Human
• Gene Symbol: HOXD4
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit
• Application: WB
• Predicted Homology Based on Immunogen Sequence: Cow: 93%; Dog: 85%; Guinea Pig: 86%; Horse: 93%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%
• Image 1: Transfected 293T
  
  WB Suggested Anti-HOXD4 Antibody Titration: 0.2-1 ug/ml
  ELISA Titer: 1:62500
  Positive Control: Transfected 293T