| Product Number |
ARP31388_P050 |
| Product Page |
http://www.avivasysbio.com/anti-hoxb6-antibody-n-terminal-region-arp31388-p050.html |
| Product Name |
HOXB6 antibody - N-terminal region (ARP31388_P050) |
| Size |
50ug |
| Gene Symbol |
HOXB6 |
| Alias Symbols |
HOX2; HU-2; HOX2B; Hox-2.2 |
| Nucleotide Accession# |
NM_018952 |
| Protein Accession# |
NP_061825 |
| Swissprot Id |
P17509 |
| Protein Size (# AA) |
224 amino acids |
| Molecular Weight |
25kDa |
| Product Format |
Lyophilized powder |
| NCBI Gene Id |
3216 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Purification |
Affinity Purified |
| Official Gene Full Name |
Homeobox B6 |
| Description |
This is a rabbit polyclonal antibody against HOXB6. It was validated on Western Blot using a cell lysate as a positive control. Aviva Systems Biology strives to provide antibodies covering each member of a whole protein family of your interest. We also use our best efforts to provide you antibodies recognize various epitopes of a target protein. For availability of antibody needed for your experiment, please inquire (info@avivasysbio.com). |
| Peptide Sequence |
Synthetic peptide located within the following region: ALSGADEQPPFHPEPRKSDCAQDKSVFGETEEQKCSTPVYPWMQRMNSCN |
| Key Reference |
Sawcer,S., et al., (1996) Nat. Genet. 13 (4), 464-468 |
| Description of Target |
HOXB6 belongs to the homeobox family. The homeobox genes encode a highly conserved family of transcription factors that play an important role in morphogenesis in all multicellular organisms. Mammals possess four similar homeobox gene clusters, HOXA, HOXB, HOXC and HOXD, located on different chromosomes, consisting of 9 to 11 genes arranged in tandem. This gene is one of several homeobox HOXB genes located in a cluster on chromosome 17. |
| Reconstitution and Storage |
Add 50 μl of distilled water. Final anti-HOXB6 antibody concentration is 1 mg/ml in PBS buffer. For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles. |
| Lead Time |
Domestic: within 24 hours delivery
International: 3-5 business days |
| Blocking Peptide |
For anti-HOXB6 antibody is Catalog # AAP31388 (Previous Catalog # AAPP03056) |
| Immunogen |
The immunogen for anti-HOXB6 antibody: synthetic peptide directed towards the N terminal of human HOXB6 |
| Complete computational species homology data |
HOXB6 antibody - N-terminal region (ARP31388_P050) |
| Tissue Tool |
Find tissues and cell lines supported to express HOXB6.  |
| Reviews and Data |
Computational species homology for HOXB6 antibody (ARP31388); Product Protocols: HOXB6 antibody tested with Human Fetal Intestine Tissue (ARP31388_P050) |
| Homology Short |
Mouse, Rat, Dog |
| Observed Species Reactivity |
Human, Mouse, Rat, Bovine, Dog |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Mouse: 92%; Rat: 92%; Dog: 78% |
| Image 1 | Human Intestine
 | WB Suggested Anti-HOXB6 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:12500
Positive Control: Human Intestine |
|
