HOXB6 Antibody - N-terminal region (ARP31388_P050)

Data Sheet
 
Product Number ARP31388_P050
Product Page www.avivasysbio.com/hoxb6-antibody-n-terminal-region-arp31388-p050.html
Name HOXB6 Antibody - N-terminal region (ARP31388_P050)
Protein Size (# AA) 224 amino acids
Molecular Weight 25kDa
NCBI Gene Id 3216
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name Homeobox B6
Alias Symbols HOX2, HU-2, HOX2B, Hox-2.2
Peptide Sequence Synthetic peptide located within the following region: ALSGADEQPPFHPEPRKSDCAQDKSVFGETEEQKCSTPVYPWMQRMNSCN
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Sawcer,S., et al., (1996) Nat. Genet. 13 (4), 464-468
Description of Target HOXB6 belongs to the homeobox family. The homeobox genes encode a highly conserved family of transcription factors that play an important role in morphogenesis in all multicellular organisms. Mammals possess four similar homeobox gene clusters, HOXA, HOXB, HOXC and HOXD, located on different chromosomes, consisting of 9 to 11 genes arranged in tandem. This gene is one of several homeobox HOXB genes located in a cluster on chromosome 17.
Protein Interactions CLK3; CREBBP; ALX4; TCEAL1; TCF21; PLSCR1; EP300; PKNOX1; SAT1; KRT15; HOXB7; CSNK2B;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-HOXB6 (ARP31388_P050) antibody
Blocking Peptide For anti-HOXB6 (ARP31388_P050) antibody is Catalog # AAP31388 (Previous Catalog # AAPP03056)
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human HOXB6
Uniprot ID P17509
Protein Name Homeobox protein Hox-B6
Protein Accession # NP_061825
Purification Affinity Purified
Nucleotide Accession # NM_018952
Tested Species Reactivity Human
Gene Symbol HOXB6
Predicted Species Reactivity Human, Mouse, Rat, Dog, Guinea Pig, Horse, Pig, Rabbit
Application WB
Predicted Homology Based on Immunogen Sequence Dog: 79%; Guinea Pig: 92%; Horse: 93%; Human: 100%; Mouse: 93%; Pig: 93%; Rabbit: 93%; Rat: 93%
Image 1
Human Intestine
WB Suggested Anti-HOXB6 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:12500
Positive Control: Human Intestine
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com