EN2 Antibody - C-terminal region (ARP31375_P050)

Data Sheet
 
Product Number ARP31375_P050
Product Page www.avivasysbio.com/en2-antibody-c-terminal-region-arp31375-p050.html
Name EN2 Antibody - C-terminal region (ARP31375_P050)
Protein Size (# AA) 333 amino acids
Molecular Weight 34kDa
NCBI Gene Id 2020
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name Engrailed homeobox 2
Alias Symbols -
Peptide Sequence Synthetic peptide located within the following region: NESQIKIWFQNKRAKIKKATGNKNTLAVHLMAQGLYNHSTTAKEGKSDSE
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Description of Target Homeobox-containing genes are thought to have a role in controlling development. The human engrailed homologs 1 and 2 encode homeodomain-containing proteins and have been implicated in the control of pattern formation during development of the central nervous system.
Protein Interactions FOXA2;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-EN2 (ARP31375_P050) antibody
Blocking Peptide For anti-EN2 (ARP31375_P050) antibody is Catalog # AAP31375
Immunogen The immunogen is a synthetic peptide directed towards the C-terminal region of Human EN2
Uniprot ID P19622
Protein Name Homeobox protein engrailed-2
Protein Accession # NP_001418
Purification Affinity Purified
Nucleotide Accession # NM_001427
Tested Species Reactivity Human
Gene Symbol EN2
Predicted Species Reactivity Human, Mouse, Rat, Dog, Guinea Pig, Horse, Zebrafish
Application IHC, WB
Predicted Homology Based on Immunogen Sequence Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rat: 100%; Zebrafish: 85%
Image 1
Human kidney
Rabbit Anti-EN2 Antibody
Catalog Number: ARP31375
Paraffin Embedded Tissue: Human Kidney
Cellular Data: Epithelial cells of renal tubule
Antibody Concentration: 4.0-8.0 ug/ml
Magnification: 400X
Image 2
Human Kidney
Human Kidney
Image 3
293T, Ovary tumor
Host: Rabbit
Target: EN2
Positive control (+): 293T (2T)
Negative control (-): Ovary tumor (T-OV)
Antibody concentration: 3ug/ml
Image 4
Human Jurkat
Host: Rabbit
Target Name: EN2
Sample Tissue: Human Jurkat
Antibody Dilution: 1.0ug/ml
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com