Product Number |
ARP31375_P050 |
Product Page |
www.avivasysbio.com/en2-antibody-c-terminal-region-arp31375-p050.html |
Name |
EN2 Antibody - C-terminal region (ARP31375_P050) |
Protein Size (# AA) |
333 amino acids |
Molecular Weight |
34kDa |
NCBI Gene Id |
2020 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
0.5 mg/ml |
Gene Full Name |
Engrailed homeobox 2 |
Alias Symbols |
- |
Peptide Sequence |
Synthetic peptide located within the following region: NESQIKIWFQNKRAKIKKATGNKNTLAVHLMAQGLYNHSTTAKEGKSDSE |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Description of Target |
Homeobox-containing genes are thought to have a role in controlling development. The human engrailed homologs 1 and 2 encode homeodomain-containing proteins and have been implicated in the control of pattern formation during development of the central nervous system. |
Protein Interactions |
FOXA2; |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-EN2 (ARP31375_P050) antibody |
Blocking Peptide |
For anti-EN2 (ARP31375_P050) antibody is Catalog # AAP31375 |
Immunogen |
The immunogen is a synthetic peptide directed towards the C-terminal region of Human EN2 |
Uniprot ID |
P19622 |
Protein Name |
Homeobox protein engrailed-2 |
Protein Accession # |
NP_001418 |
Purification |
Affinity Purified |
Nucleotide Accession # |
NM_001427 |
Tested Species Reactivity |
Human |
Gene Symbol |
EN2 |
Predicted Species Reactivity |
Human, Mouse, Rat, Dog, Guinea Pig, Horse, Zebrafish |
Application |
IHC, WB |
Predicted Homology Based on Immunogen Sequence |
Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rat: 100%; Zebrafish: 85% |
Image 1 | Human kidney
| Rabbit Anti-EN2 Antibody Catalog Number: ARP31375 Paraffin Embedded Tissue: Human Kidney Cellular Data: Epithelial cells of renal tubule Antibody Concentration: 4.0-8.0 ug/ml Magnification: 400X |
| Image 2 | Human Kidney
| Human Kidney |
| Image 3 | 293T, Ovary tumor
| Host: Rabbit Target: EN2 Positive control (+): 293T (2T) Negative control (-): Ovary tumor (T-OV) Antibody concentration: 3ug/ml |
| Image 4 | Human Jurkat
| Host: Rabbit Target Name: EN2 Sample Tissue: Human Jurkat Antibody Dilution: 1.0ug/ml |
|
|