Arnt antibody - N-terminal region (ARP30978_P050)
Data Sheet
 
Product Number ARP30978_P050
Product Page www.avivasysbio.com/arnt-antibody-n-terminal-region-arp30978-p050.html
Product Name Arnt antibody - N-terminal region (ARP30978_P050)
Size 100 ul
Gene Symbol Arnt
Alias Symbols D3Ertd557e, Drnt, ESTM42, Hif1b, KIAA4051, W08714, bHLHe2, mKIAA4051
Protein Size (# AA) 776 amino acids
Molecular Weight 85kDa
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
NCBI Gene Id 11863
Host Rabbit
Clonality Polyclonal
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Official Gene Full Name Aryl hydrocarbon receptor nuclear translocator
Description This is a rabbit polyclonal antibody against Arnt. It was validated on Western Blot by Aviva Systems Biology. At Aviva Systems Biology we manufacture rabbit polyclonal antibodies on a large scale (200-1000 products/month) of high throughput manner. Our antibodies are peptide based and protein family oriented. We usually provide antibodies covering each member of a whole protein family of your interest. We also use our best efforts to provide you antibodies recognize various epitopes of a target protein. For availability of antibody needed for your experiment, please inquire (info@avivasysbio.com).
Description of Target The function of Arnt remains unknown.
Blocking Peptide For anti-Arnt (ARP30978_P050) antibody is Catalog # AAP30978 (Previous Catalog # AAPS08304)
Immunogen The immunogen is a synthetic peptide corresponding to a region of Mouse
Complete computational species homology data Anti-Arnt (ARP30978_P050)
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express Arnt.
Peptide Sequence Synthetic peptide located within the following region: DEVEVNTKFLRCDDDQMCNDKERFARENHSEIERRRRNKMTAYITELSDM
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Swissprot Id Q3ULM2
Protein Name Aryl hydrocarbon receptor nuclear translocator Ensembl ENSMUSP00000088313
Protein Accession # NP_033839
Purification Affinity Purified
Protein Interactions Calcoco1; EPAS1; Sim2; Npas1; Sim1; Ahr;
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express Arnt.
Nucleotide Accession # NM_009709
Replacement Item This antibody may replace item sc-17811 from Santa Cruz Biotechnology.
CB Replacement sc-17811; sc-17812; sc-271801; sc-29733; sc-55526; sc-5580; sc-56620; sc-65639; sc-70383; sc-8076; sc-8077
Conjugation Options

ARP30978_P050-FITC Conjugated

ARP30978_P050-HRP Conjugated

ARP30978_P050-Biotin Conjugated

Lead Time Domestic: within 1-2 days delivery International: 1-2 days
CB Tag transcription factor
Species Reactivity Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 92%; Rabbit: 100%; Rat: 100%; Sheep: 100%; Zebrafish: 100%
Image 1
Mouse Liver
WB Suggested Anti-Arnt Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: Mouse Liver
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
5754 Pacific Center Blvd., Suite 201 San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com