| Product Number |
ARP30947_P050 |
| Product Page |
www.avivasysbio.com/pax7-antibody-middle-region-arp30947-p050.html |
| Name |
Pax7 Antibody - middle region (ARP30947_P050) |
| Protein Size (# AA) |
503 amino acids |
| Molecular Weight |
55 kDa |
| NCBI Gene Id |
500574 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Paired box 7 |
| Description |
|
| Alias Symbols |
RGD1564360 |
| Peptide Sequence |
Synthetic peptide located within the following region: SDVESEPDLPLKRKQRRSRTTFTAEQLEELEKAFERTHYPDIYTREELAQ |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Description of Target |
The function of Pax7 remains unknown. |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Enhanced Validation |
| Relative Expression (Western Blot) |
 |
|
| Datasheets/Manuals |
Printable datasheet for anti-Pax7 (ARP30947_P050) antibody |
| Other Applications Image 1 Data |
Immunofluorescence --
Sample Type: Overexpression of Pax7 in C2C12 cells
Dilution: 1:100 |
| Other Applications Image 2 Data |
Immunofluorescence --
Sample Type: SC derived myoblasts
Dilution: 1:100 |
| Blocking Peptide |
For anti-Pax7 (ARP30947_P050) antibody is Catalog # AAP30947 (Previous Catalog # AAPP24013) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human Pax7 |
| Publications |
Ezin, A. M., Sechrist, J. W., Zah, A., Bronner, M. & Fraser, S. E. Early regulative ability of the neuroepithelium to form cardiac neural crest. Dev. Biol. 349, 238-49 (2011). 21047505
mRNP granule proteins Fmrp and Dcp1a differentially regulate mRNP complexes to contribute to control of muscle stem cell quiescence and activation. Skelet Muscle. 11, 18 (2021). 34238354
Van Ry, P. M., Minogue, P., Hodges, B. L. & Burkin, D. J. Laminin-111 improves muscle repair in a mouse model of merosin-deficient congenital muscular dystrophy. Hum. Mol. Genet. (2013). doi:10.1093/hmg/ddt428 24009313 |
| Protein Accession # |
NP_001178913 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_001191984 |
| Tested Species Reactivity |
Human, Mouse, Rat |
| Gene Symbol |
Pax7 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Goat, Guinea Pig, Rabbit, Zebrafish |
| Application |
IF, WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 100%; Goat: 86%; Guinea Pig: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100% |
| Image 1 | Mouse C2C12
 | Sample Type : C2C12 |
|
| Image 2 | Mouse C2C12
 | Immunofluorescence -- Sample Type: Overexpression of Pax7 in C2C12 cellsDilution: 1:100 |
|
| Image 3 | Rat Muscle
 | WB Suggested Anti-Pax7 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Rat Muscle |
|
| Image 4 |
 | Surface Plasmon Resonance Kinetic Characterization of Polyclonal Antibody Affinity. Purified polyclonal antibodies were immobilized on a Protein A/G coated Carterra LSA sensor chip (PAGH200M) at concentrations of 5, and 50 ug/mL in duplicate. Antibodies on the surface were exposed to interaction with peptides sequentially via microfluidic controlled flow at 333nM peptide concentration for kinetic characterization of the binders for affinity and specificity, followed by curve fitting using the Kinetics software. Kd determinations for both concentrations were averaged and results and standard deviation are shown.
|
|
| Image 5 |
 | 25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 1 ug/mL of the antibody was used in this experiment.
|
|
