OAS1 Antibody - C-terminal region (ARP30587_P050)

• Product Number: ARP30587_P050
• Name: OAS1 Antibody - C-terminal region (ARP30587_P050)
• Protein Size (# AA): 400 amino acids
• Molecular Weight: 46kDa
• NCBI Gene Id: 4938
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Gene Full Name: 2'-5'-oligoadenylate synthetase 1, 40/46kDa
• Alias Symbols: OIAS, IFI-4, OIASI, E18/E16
• Peptide Sequence: Synthetic peptide located within the following region: EAWLNYPCFKNWDGSPVSSWILLAESNSADDETDDPRRYQKYGYIGTHEY
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Description of Target: OAS1 is a member of the 2-5A synthetase family, essential proteins involved in the innate immune response to viral infection. It is induced by interferons and uses adenosine triphosphate in 2'-specific nucleotidyl transfer reactions to synthesize 2',5'-oligoadenylates (2-5As). These molecules activate latent RNase L, which results in viral RNA degradation and the inhibition of viral replication. Mutations in this gene have been associated with host susceptibility to viral infection.
• Protein Interactions: EXOC5; TRIM27; ACTN1; PRMT6; WBSCR22; RPL30; HCVgp1;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Blocking Peptide: For anti-OAS1 (ARP30587_P050) antibody is Catalog # AAP30587
• Uniprot ID: P00973
• Protein Name: 2'-5'-oligoadenylate synthase 1
• Publications:

  Li, Q. & Tainsky, M. A. Higher miRNA tolerance in immortal Li-Fraumeni fibroblasts with abrogated interferon signaling pathway. Cancer Res. 71, 255-65 (2011). 21199806

• Sample Type Confirmation:

  OAS1 is strongly supported by BioGPS gene expression data to be expressed in HEK293T, MCF7

• Protein Accession #: NP_058132
• Purification: Affinity Purified
• Nucleotide Accession #: NM_016816
• Tested Species Reactivity: Human
• Gene Symbol: OAS1
• Predicted Species Reactivity: Human
• Application: IHC, WB
• Predicted Homology Based on Immunogen Sequence: Human: 100%
• Image 1: Human Fetal Brain
  
  Host: Rabbit
  Target Name: OAS1
  Sample Type: Human Fetal Brain
  Antibody Dilution: 1.0ug/ml
• Image 2: Human MCF7
  
  Host: Rabbit
  Target Name: OAS1
  Sample Type: Human MCF7
  Antibody Dilution: 1.0ug/ml.OAS1 is strongly supported by BioGPS gene expression data to be expressed in MCF7
• Image 3: Human HEK293T
  
  Host: Rabbit
  Target Name: OAS1
  Sample Type: Human 293T
  Antibody Dilution: 1.0ug/mlOAS1 is strongly supported by BioGPS gene expression data to be expressed in Human HEK293T cells
• Image 4: Human HepG2
  
  WB Suggested Anti-OAS1 Antibody Titration: 1 ug/ml
  Positive Control: HepG2 cell lysate
• Image 5: Human Small intestine
  
  Immunohistochemistry with Small intestine tissue at an antibody concentration of 5ug/ml using anti-OAS1 antibody (ARP30587_P050)
• Image 6: Human Stomach Tumor, 293T Cell Lysate
  
  Host: Rabbit
  Target: OAS1
  Positive control (+): Human Stomach Tumor (T-ST)
  Negative control (-): 293T Cell Lysate (2T)
  Antibody concentration: 3ug/ml