TLR2 Antibody - C-terminal region (ARP30551_P050)

• Product Number: ARP30551_P050
• Name: TLR2 Antibody - C-terminal region (ARP30551_P050)
• Protein Size (# AA): 784 amino acids
• Molecular Weight: 90 kDa
• NCBI Gene Id: 7097
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Gene Full Name: Toll-like receptor 2
• Alias Symbols: TIL4, CD282
• Peptide Sequence: Synthetic peptide located within the following region: LEPIEKKAIPQRFCKLRKIMNTKTYLEWPMDEAQREGFWVNLRAAIKS
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reference: Niebuhr,M., (2008) Allergy 63 (6), 728-734
• Description of Target: TLR2 is a member of the Toll-like receptor (TLR) family which plays a fundamental role in pathogen recognition and activation of innate immunity. TLRs are highly conserved from Drosophila to humans and share structural and functional similarities. They recognize pathogen-associated molecular patterns (PAMPs) that are expressed on infectious agents, and mediate the production of cytokines necessary for the development of effective immunity. The various TLRs exhibit different patterns of expression. This gene is expressed most abundantly in peripheral blood leukocytes, and mediates host response to Gram-positive bacteria and yeast via stimulation of NF-kappaB. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
• Protein Interactions: ATG16L1; IRF3; CREBBP; CLEC7A; CLEC4M; TIRAP; MAPK8IP3; TICAM1; TOLLIP; TLR10; TLR6; LY96; RIPK2; TRIP6; MYD88; RAC1; TLR1; IRAK1; HSP90B1; HRAS; SFTPA1; PIK3R1; HMGB1; CD14; TLR2;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Enhanced Validation: Relative Expression (Western Blot)
  
• Other Applications Image 1 Data: IHC Information: Lung
  
• Other Applications Image 2 Data: IHC Information: Human Thymus: Formalin-Fixed, Paraffin-Embedded (FFPE)
• Blocking Peptide: For anti-TLR2 (ARP30551_P050) antibody is Catalog # AAP30551 (Previous Catalog # AAPP01203)
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human TLR2
• Uniprot ID: O60603
• Protein Name: Toll-like receptor 2
• Publications:

  Expression of Toll-like receptors 2, 4 and 6 in different cell populations of the equine endometrium. Vet. Immunol. Immunopathol. 185, 7-13 (2017). 28242004

  Expression of Toll-like receptors 2, 4 and 6 in equine endometrial epithelial cells: A comparative in situ and in vitro study. Res. Vet. Sci. 112, 34-41 (2017). 28119161

• Protein Accession #: NP_003255
• Purification: Affinity Purified
• Nucleotide Accession #: NM_003264
• Tested Species Reactivity: Human
• Gene Symbol: TLR2
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Goat, Guinea Pig, Horse, Sheep, Zebrafish
• Application: IF, IHC-FFPE, WB
• Predicted Homology Based on Immunogen Sequence: Cow: 91%; Dog: 85%; Goat: 85%; Guinea Pig: 79%; Horse: 92%; Human: 100%; Mouse: 91%; Rat: 92%; Sheep: 91%; Zebrafish: 100%
• Image 1: Human macrophages
  
  Sample Type: Human Macrophange Cells
  Green: primary
  Red: phallodin
  Blue: DAPI
  Yellow: green/red
  Primary Dilution: 1:200
  Secondary Antibody: anti-Rabbit IgG-FITC
  Secondary Dilution: 1:1000
  Image Submitted By: Milan Fiala
  University of California, Los Angeles 
• Image 2: Human thymus
  
  Immunohistochemistry with pFA fixed human thymus tissue
• Image 3: Human Liver
  
  Immunohistochemistry with Liver tissue at an antibody concentration of 5.0ug/ml using anti-TLR2 antibody (ARP30551_P050)
• Image 4: human lung
  
  IHC Information: Lung
• Image 5: human macrophages
  
  IF Information: human macrophages
• Image 6: Human OVCAR-3
  
  Host: Rabbit
  Target Name: TLR2
  Sample Tissue: Human OVCAR-3
  Antibody Dilution: 1.0ug/ml
• Image 7:
  
  25 ug of the indicated Human whole cell extracts was loaded onto a 6-18% SDS-PAGE gel. 0.05 ug/mL of the antibody was used in this experiment. An isoform containing the peptide sequence is present at 23 kDa.