CRK antibody - C-terminal region (ARP30416_P050)
Data Sheet
 
Product Number ARP30416_P050
Product Page http://www.avivasysbio.com/crk-antibody-c-terminal-region-arp30416-p050.html
Product Name CRK antibody - C-terminal region (ARP30416_P050)
Size 50ug
Gene Symbol CRK
Alias Symbols CRKII; p38
Nucleotide Accession# NM_016823
Protein Accession# NP_058431
Swissprot Id P46108
Protein Size (# AA) 304 amino acids
Molecular Weight 34kDa
Product Format Lyophilized powder
NCBI Gene Id 1398
Host Rabbit
Official Gene Full Name V-crk sarcoma virus CT10 oncogene homolog (avian)
Description This is a rabbit polyclonal antibody against CRK. It was validated on Western Blot by Aviva Systems Biology. At Aviva Systems Biology we manufacture rabbit polyclonal antibodies on a large scale (200-1000 products/month) of high throughput manner. Our antibodies are peptide based and protein family oriented. We usually provide antibodies covering each member of a whole protein family of your interest. We also use our best efforts to provide you antibodies recognize various epitopes of a target protein. For availability of antibody needed for your experiment, please inquire (info@avivasysbio.com).
Peptide Sequence Synthetic peptide located within the following region: IPVPYVEKYRPASASVSALIGGNQEGSHPQPLGGPEPGPYAQPSVNTPLP
Key Reference N/A
Description of Target This gene encodes a member of an adapter protein family that binds to several tyrosine-phosphorylated proteins. The product of this gene has several SH2 and SH3 domains (src-homology domains) and is involved in several signaling pathways, recruiting cytoplasmic proteins in the vicinity of tyrosine kinase through SH2-phosphotyrosine interaction. The N-terminal SH2 domain of this protein functions as a positive regulator of transformation whereas the C-terminal SH3 domain functions as a negative regulator of transformation. Two alternative transcripts encoding different isoforms with distinct biological activity have been described.
Partner Proteins ZAP70,MAP4K1,ABL1,ABL2,ABL2,PDGFRB,ZAP70,ABL1,ABL2,ARHGAP32,ATXN1,AVIL,BCAR1,BCR,BUB1,CBL,CBLC,CRKL,DAB1,DOCK1,DOCK3,DOK4,DPPA4,EGFR,EPHA3,EPHB3,EPHB6,EPS15,ERBB4,FGFR1,FLT1,FRS2,FYN,GAB1,GRB2,IGF1R,INSR,IRS1,IRS2,IRS4,KDR,KIT,MAP4K1,MAP4K5,MAPK8,NCK1,NEDD9,NTRK1,PDGFRA,PDGFRB,PIK3R1,PLSCR1,PSMC6,PTK2,PTK2B,PXN,RAPGEF1,REPS1,RET,SH3BP1,SHB,SHC1,SOS1,STAT5A,STAT5B,SYN1,VAV1,WASF1,WEE1,XPO1,ZAP70,ABL1,ARHGAP17,ARHGAP32,ARHGAP32,ASAP1,ASAP1,AVIL,BCAR1,BUB1,CBL,CBLC,DOCK1,DOK4,DPPA4,EGFR,EPHA3,EPHB2,EPHB3,EPS15,ERBB4,FRS2,GRB2,IRS4,KCNIP3,KHDRBS1,MAP4K1,MAP4K5,MAPK8,MICAL1,NCK1,NEDD9,PDGFRA,PDGFRB,PLSCR1,PSMC6,PTK2,PTPN1,PXN,RAPGEF1,RET,SH3BP1,SH3KBP1,SHB,SOCS1,SOS1,SRC,SRCIN1,SYN1,VAV2,WEE1,XPO1,ZAP70,xpo1
Reconstitution and Storage Add 50 μl of distilled water. Final anti-CRK antibody concentration is 1 mg/ml in PBS buffer. For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.
Lead Time Domestic: within 24 hours delivery  International: 3-5 business days
Blocking Peptide For anti-CRK antibody is Catalog # AAP30416
Complete computational species homology data CRK antibody - C-terminal region (ARP30416_P050)
Tissue Tool Find tissues and cell lines supported to express CRK.
Reviews and Data Computational species homology for CRK antibody (ARP30416)
Homology Short African clawed frog, Bovine, Dog, Guinea pig, Horse, Human, Mouse, Rat, Chicken
Observed Species Reactivity Human
Application WB
Predicted Homology Based on Immunogen Sequence African clawed frog: 100%; Bovine: 100%; Dog: 100%; Guinea pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rat: 100%; Chicken: 90%
Image 1
Transfected 293T
WB Suggested Anti-CRK Antibody
Titration: 1.0 ug/ml
Positive Control: Transfected 293T
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

This product is for Research Use Only. Not for diagnostic, human, or veterinary use.
Optimal conditions of its use should be determined by end users.

__________________________________________________________________________________________________________________________________________________________________

AVIVA SYSTEMS BIOLOGY
5754 Pacific Center Blvd., Suite 201 San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com