TP53 Antibody - N-terminal region (ARP30311_P050)

Data Sheet
 
Product Number ARP30311_P050
Product Page www.avivasysbio.com/tp53-antibody-n-terminal-region-arp30311-p050.html
Name TP53 Antibody - N-terminal region (ARP30311_P050)
Protein Size (# AA) 393 amino acids
Molecular Weight 44kDa
NCBI Gene Id 7157
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Alias Symbols P53, BCC7, LFS1, BMFS5, TRP53
Peptide Sequence Synthetic peptide located within the following region: EEPQSDPSVEPPLSQETFSDLWKLLPENNVLSPLPSQAMDDLMLSPDDIE
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Boehme,K.A., (2008) Proc. Natl. Acad. Sci. U.S.A. 105 (22), 7785-7790
Description of Target TP53 acts as a tumor suppressor in many tumor types; induces growth arrest or apoptosis depending on the physiological circumstances and cell type. Involved in cell cycle regulation as a trans-activator that acts to negatively regulate cell division by controlling a set of genes required for this process. This gene encodes tumor protein p53, which responds to diverse cellular stresses to regulate target genes that induce cell cycle arrest, apoptosis, senescence, DNA repair, or changes in metabolism. p53 protein is expressed at low level in normal cells and at a high level in a variety of transformed cell lines, where it's believed to contribute to transformation and malignancy. p53 is a DNA-binding protein containing transcription activation, DNA-binding, and oligomerization domains. It is postulated to bind to a p53-binding site and activate expression of downstream genes that inhibit growth and/or invasion, and thus function as a tumor suppressor. Mutants of p53 that frequently occur in a number of different human cancers fail to bind the consensus DNA binding site, and hence cause the loss of tumor suppressor activity. Alterations of this gene occur not only as somatic mutations in human malignancies, but also as germline mutations in some cancer-prone families with Li-Fraumeni syndrome. Multiple p53 variants due to alternative promoters and multiple alternative splicing have been found. These variants encode distinct isoforms, which can regulate p53 transcriptional activity.
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-TP53 (ARP30311_P050) antibody
Additional Information IHC Information: Kidney
Blocking Peptide For anti-TP53 (ARP30311_P050) antibody is Catalog # AAP30311 (Previous Catalog # AAPS08801)
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human TP53
Uniprot ID P04637
Protein Name Cellular tumor antigen p53
Sample Type Confirmation

TP53 is strongly supported by BioGPS gene expression data to be expressed in DU145, HEK293T

Protein Accession # NP_000537
Purification Affinity Purified
Nucleotide Accession # NM_000546
Tested Species Reactivity Human
Gene Symbol TP53
Predicted Species Reactivity Human
Application CHIP, IHC, WB
Predicted Homology Based on Immunogen Sequence Human: 100%
Image 1
Human DU145
WB Suggested Anti-TP53 Antibody
Titration: 0.5 ug/ml
Positive Control: DU145 CELLSTP53 is strongly supported by BioGPS gene expression data to be expressed in Human DU145 cells
Image 2
Human 293T
WB Suggested Anti-TP53 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: 293T cell lysate.TP53 is strongly supported by BioGPS gene expression data to be expressed in HEK293T
Image 3
Human Kidney
Kidney
Image 4
Human DU145
Sample Type : human DU145 cells
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com