Product Number |
ARP30307_P050 |
Product Page |
www.avivasysbio.com/tp53-antibody-n-terminal-region-arp30307-p050.html |
Name |
TP53 Antibody - N-terminal region (ARP30307_P050) |
Protein Size (# AA) |
393 amino acids |
Molecular Weight |
44 kDa |
NCBI Gene Id |
7157 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
0.5 mg/ml |
Alias Symbols |
P53, BCC7, LFS1, BMFS5, TRP53 |
Peptide Sequence |
Synthetic peptide located within the following region: EEPQSDPSVEPPLSQETFSDLWKLLPENNVLSPLPSQAMDDLMLSPDDIE |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Reference |
Boehme,K.A., (2008) Proc. Natl. Acad. Sci. U.S.A. 105 (22), 7785-7790 |
Description of Target |
TP53 acts as a tumor suppressor in many tumor types; induces growth arrest or apoptosis depending on the physiological circumstances and cell type. Involved in cell cycle regulation as a trans-activator that acts to negatively regulate cell division by controlling a set of genes required for this process. This gene encodes tumor protein p53, which responds to diverse cellular stresses to regulate target genes that induce cell cycle arrest, apoptosis, senescence, DNA repair, or changes in metabolism. p53 protein is expressed at low level in normal cells and at a high level in a variety of transformed cell lines, where it's believed to contribute to transformation and malignancy. p53 is a DNA-binding protein containing transcription activation, DNA-binding, and oligomerization domains. It is postulated to bind to a p53-binding site and activate expression of downstream genes that inhibit growth and/or invasion, and thus function as a tumor suppressor. Mutants of p53 that frequently occur in a number of different human cancers fail to bind the consensus DNA binding site, and hence cause the loss of tumor suppressor activity. Alterations of this gene occur not only as somatic mutations in human malignancies, but also as germline mutations in some cancer-prone families with Li-Fraumeni syndrome. Multiple p53 variants due to alternative promoters and multiple alternative splicing have been found. These variants encode distinct isoforms, which can regulate p53 transcriptional activity. |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Enhanced Validation |
|
Datasheets/Manuals |
Printable datasheet for anti-TP53 (ARP30307_P050) antibody |
Additional Information |
IHC Information: Skin IHC Information: Kidney |
Blocking Peptide |
For anti-TP53 (ARP30307_P050) antibody is Catalog # AAP30307 (Previous Catalog # AAPS08710) |
Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human TP53 |
Uniprot ID |
P04637 |
Protein Name |
Cellular tumor antigen p53 |
Sample Type Confirmation |
TP53 is strongly supported by BioGPS gene expression data to be expressed in 721_B, HEK293T |
Protein Accession # |
NP_000537 |
Purification |
Affinity Purified |
Nucleotide Accession # |
NM_000546 |
Tested Species Reactivity |
Human |
Gene Symbol |
TP53 |
Predicted Species Reactivity |
Human, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit, Sheep |
Application |
CHIP, IHC, WB |
Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 80%; Guinea Pig: 90%; Horse: 90%; Human: 100%; Pig: 100%; Rabbit: 100%; Rat: 90%; Sheep: 100% |
Image 1 | Human 293T
| WB Suggested Anti-TP53 Antibody Titration: 0.2-1 ug/ml ELISA Titer: 1:1562500 Positive Control: 293T cell lysate.TP53 is strongly supported by BioGPS gene expression data to be expressed in HEK293T |
|
Image 2 | Human U2OS, PLKO
| Immunohistochemistry with U20S/ PLKO cells tissue |
|
Image 3 | Human U2OS, PLKO
| Immunohistochemistry with U20S/ PLKO cells tissue |
|
Image 4 | Human U2OS, PLKO
| Sample Type : U20S/ PLKO cells |
|
Image 5 | Human 721_B
| Host: Rabbit Target Name: TP53 Sample Type: Human 721_B Antibody Dilution: 1.0ug/mlTP53 is strongly supported by BioGPS gene expression data to be expressed in Human 721_B cells |
|
Image 6 | Human Adult Placenta
| Host: Rabbit Target Name: TP53 Sample Type: Human Adult Placenta Antibody Dilution: 1.0ug/ml |
|
Image 7 | Human Lymph Node
| Rabbit Anti-TP53 Antibody Catalog Number: ARP30307_P050 Formalin Fixed Paraffin Embedded Tissue: Human Lymph Node Tissue Observed Staining: Nucleus, Cytoplasm Primary Antibody Concentration: 1:100 Other Working Concentrations: 1:600 Secondary Antibody: Donkey anti-Rabbit-Cy3 Secondary Antibody Concentration: 1:200 Magnification: 20X Exposure Time: 0.5 - 2.0 sec |
|