RGS4 Antibody - C-terminal region (ARP30213_P050)

• Product Number: ARP30213_P050
• Name: RGS4 Antibody - C-terminal region (ARP30213_P050)
• Protein Size (# AA): 205 amino acids
• Molecular Weight: 23kDa
• NCBI Gene Id: 5999
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Gene Full Name: Regulator of G-protein signaling 4
• Alias Symbols: RGP4, SCZD9
• Peptide Sequence: Synthetic peptide located within the following region: EAQKKIFNLMEKDSYRRFLKSRFYLDLVNPSSCGAEKQKGAKSSADCASL
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reference: Ishii,M., (2005) Biochem. Biophys. Res. Commun. 338 (2), 839-846
• Description of Target: Regulator of G protein signaling (RGS) family members are regulatory molecules that act as GTPase activating proteins (GAPs) for G alpha subunits of heterotrimeric G proteins. RGS proteins are able to deactivate G protein subunits of the Gi alpha, Go alpha and Gq alpha subtypes. They drive G proteins into their inactive GDP-bound forms. Regulator of G protein signaling 4 belongs to this family. All RGS proteins share a conserved 120-amino acid sequence termed the RGS domain. This protein negatively regulates signaling upstream or at the level of the heterotrimeric G protein and is localized in the cytoplasm.Regulator of G protein signaling (RGS) family members are regulatory molecules that act as GTPase activating proteins (GAPs) for G alpha subunits of heterotrimeric G proteins. RGS proteins are able to deactivate G protein subunits of the Gi alpha, Go alpha and Gq alpha subtypes. They drive G proteins into their inactive GDP-bound forms. Regulator of G protein signaling 4 belongs to this family. All RGS proteins share a conserved 120-amino acid sequence termed the RGS domain. Regulator of G protein signaling 4 protein is 37% identical to RGS1 and 97% identical to rat Rgs4. This protein negatively regulate signaling upstream or at the level of the heterotrimeric G protein and is localized in the cytoplasm.
• Protein Interactions: GABBR1; KRIT1; PLCB1; COPB2; GNAQ; COPB1; ERBB3; PTAFR; GNAI2; GNAO1; GNAI1; CALM1; GNAI3; GNAT1;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Blocking Peptide: For anti-RGS4 (ARP30213_P050) antibody is Catalog # AAP30213 (Previous Catalog # AAPS09011)
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human RGS4
• Uniprot ID: P49798
• Protein Name: Regulator of G-protein signaling 4
• Protein Accession #: NP_005604
• Purification: Affinity Purified
• Nucleotide Accession #: NM_005613
• Tested Species Reactivity: Human
• Gene Symbol: RGS4
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Sheep
• Application: WB
• Predicted Homology Based on Immunogen Sequence: Cow: 86%; Dog: 92%; Guinea Pig: 93%; Horse: 93%; Human: 100%; Mouse: 100%; Rabbit: 86%; Rat: 100%; Sheep: 86%
• Image 1: Human Jurkat
  
  WB Suggested Anti-RGS4 Antibody Titration: 0.2-1 ug/ml
  ELISA Titer: 1:312500
  Positive Control: Jurkat cell lysate