CCNB1 Antibody - C-terminal region (ARP30161_P050)

Data Sheet
 
Product Number ARP30161_P050
Product Page www.avivasysbio.com/ccnb1-antibody-c-terminal-region-arp30161-p050.html
Name CCNB1 Antibody - C-terminal region (ARP30161_P050)
Protein Size (# AA) 433 amino acids
Molecular Weight 48kDa
NCBI Gene Id 891
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name Cyclin B1
Alias Symbols CCNB
Peptide Sequence Synthetic peptide located within the following region: YTEESLLPVMQHLAKNVVMVNQGLTKHMTVKNKYATSKHAKISTLPQLNS
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Zhao,M., (2006) Exp Oncol 28 (1), 44-48
Description of Target CCNB1 is a regulatory protein involved in mitosis. CCNB1 complexes with p34(cdc2) to form the maturation-promoting factor (MPF).The protein encoded by this gene is a regulatory protein involved in mitosis. The gene product complexes with p34(cdc2) to form the maturation-promoting factor (MPF). Two alternative transcripts have been found, a constitutively expressed transcript and a cell cycle-regulated transcript, that is expressed predominantly during G2/M phase. The different transcripts result from the use of alternate transcription initiation sites.
Protein Interactions CDC27; CDC20; CDH1; ANAPC11; FZR1; ANAPC4; SIRT1; BTRC; CDC16; UBC; CDKN1A; VCP; Samhd1; CKS2; CKS1B; RHOBTB3; CDK1; CDK5; CDK2; SQSTM1; PTMA; TP73; TP53BP1; POLA1; RB1; CDK7; HIST1H1B; CDC6; CCNB1IP1; MFN1; MARCH5; PRC1; HIST1H1A; SDHAF2; NDC80; CDT1; RP
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-CCNB1 (ARP30161_P050) antibody
Other Applications Image 1 Data IP Suggested Anti-CCNB1 Antibody
Positive Control: NT2 CELL/BRAIN TISSUE
Other Applications Image 2 Data IP Suggested Anti-CCNB1 antibody
Titration: 2 ug/ml
Positive Control: Mouse brain homogenate
Blocking Peptide For anti-CCNB1 (ARP30161_P050) antibody is Catalog # AAP30161 (Previous Catalog # AAPS08606)
Immunogen The immunogen is a synthetic peptide directed towards the C terminal region of human CCNB1
Uniprot ID P14635
Protein Name G2/mitotic-specific cyclin-B1
Sample Type Confirmation

CCNB1 is supported by BioGPS gene expression data to be expressed in Jurkat

Protein Accession # NP_114172
Purification Affinity Purified
Nucleotide Accession # NM_031966
Tested Species Reactivity Human, Mouse
Gene Symbol CCNB1
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit
Application IP, WB
Predicted Homology Based on Immunogen Sequence Cow: 92%; Dog: 85%; Guinea Pig: 92%; Horse: 85%; Human: 100%; Mouse: 92%; Rabbit: 92%; Rat: 92%
Image 1
Human Lymph Node
Rabbit Anti-CCNB1 Antibody
Catalog Number: ARP30161_P050
Formalin Fixed Paraffin Embedded Tissue: Human Lymph Node Tissue
Observed Staining: Cytoplasm
Primary Antibody Concentration: 1:600
Other Working Concentrations: N/A
Secondary Antibody: Donkey anti-Rabbit-Cy3
Secondary Antibody Concentration: 1:200
Magnification: 20X
Exposure Time: 0.5 - 2.0 sec
Image 2
Mouse Brain
Researcher: Dr. Yuzhi Chen, University of Arkansas for Medical Science
Application: IP
Species+tissue/cell type: Mouse brain homogenate
How many ug'sof tissue/cell lysate run on the gel: 500 ug mouse brain homogenateIP antibody: 6 ug
Primary antibody dilution: 1:500
Secondary antibody: Goat anti-rabbit Alexa-Fluor 594
Secondary antibody dilution: 1:5000
Image 3
Human NT2
Researcher:Dr. Yuzhi Chen, University of Arkansas for Medical Science
Application:Western blotting
Species+tissue/cell type: lane 1: 60ug human NT2 cell line
Primary antibody dilution: 1:500
Secondary antibody:IRDye 800 CW goat anti-rabbit from Li-COR Bioscience
Secondary antibody dilution:1:20,000
Image 4
human NT2 line
WB Suggested Anti-CCNB1 Antibody
Positive Control: Lane 1: 60ug human NT2 cell line
Primary Antibody Dilution : 1:500
Secondary Antibody : IRDye 800 CW goat anti-rabbit from Li-COR Bioscience
Secondry Antibody Dilution : 1:20,000
Submitted by: Dr. Yuzhi Chen, University of Arkansas for Medical Science
Image 5
Human Jurkat
WB Suggested Anti-CCNB1 Antibody Titration: 0.125ug/ml
ELISA Titer: 1:312500
Positive Control: Jurkat cell lysateCCNB1 is supported by BioGPS gene expression data to be expressed in Jurkat
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com