| Product Number |
ARP30159_P050 |
| Product Page |
www.avivasysbio.com/ccna2-antibody-c-terminal-region-arp30159-p050.html |
| Name |
Ccna2 Antibody - C-terminal region (ARP30159_P050) |
| Protein Size (# AA) |
418 amino acids |
| Molecular Weight |
47kDa |
| NCBI Gene Id |
114494 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Cyclin A2 |
| Alias Symbols |
MGC156527, Ccna2 |
| Peptide Sequence |
Synthetic peptide located within the following region: TGYTLESLKPCLMDLHQTYLKAPQHAQQSIREKYKHSKYHSVSLLNPPET |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Description of Target |
The function of Ccna2 remains unknown. |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-Ccna2 (ARP30159_P050) antibody |
| Blocking Peptide |
For anti-Ccna2 (ARP30159_P050) antibody is Catalog # AAP30159 (Previous Catalog # AAPS08605) |
| Immunogen |
The immunogen is a synthetic peptide corresponding to a region of Rat |
| Protein Accession # |
NP_446154 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_053702 |
| Tested Species Reactivity |
Human, Rat |
| Gene Symbol |
Ccna2 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Sheep, Yeast, Zebrafish |
| Application |
WB, IHC |
| Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 92%; Guinea Pig: 100%; Horse: 92%; Human: 100%; Mouse: 92%; Rabbit: 100%; Rat: 100%; Sheep: 100%; Yeast: 82%; Zebrafish: 77% |
| Image 1 | Human Lymph Node
 | Rabbit Anti-CCNA2 Antibody
Catalog Number: ARP30159_P050
Formalin Fixed Paraffin Embedded Tissue: Human Lymph Node Tissue
Observed Staining: Cytoplasm
Primary Antibody Concentration: 1:600
Other Working Concentrations: N/A
Secondary Antibody: Donkey anti-Rabbit-Cy3
Secondary Antibody Concentration: 1:200
Magnification: 20X
Exposure Time: 0.5 - 2.0 sec |
| | Image 2 | Rat Muscle
 | WB Suggested Anti-Ccna2 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Rat Muscle |
| | Image 3 | Human Testis
 | Ccna2 antibody - C-terminal region (ARP30159_P050) validated by WB using testis |
|
|
