| Product Number |
ARP30089_T100 |
| Product Page |
www.avivasysbio.com/mxd3-antibody-n-terminal-region-arp30089-t100.html |
| Name |
MXD3 Antibody - N-terminal region (ARP30089_T100) |
| Protein Size (# AA) |
206 amino acids |
| Molecular Weight |
23kDa |
| NCBI Gene Id |
83463 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
1.0 mg/ml |
| Gene Full Name |
MAX dimerization protein 3 |
| Alias Symbols |
MYX, MAD3, BHLHC13 |
| Peptide Sequence |
Synthetic peptide located within the following region: PIHRRKKRPPQAPGAQDSGRSVHNELEKRRRAQLKRCLERLKQQMPLGAD |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Suzuki,Y., Gene 200 (1-2), 149-156 (1997) |
| Description of Target |
MXD3 contains 1 basic helix-loop-helix (bHLH) domain. It is a transcriptional repressor and binds with MAX to form a sequence-specific DNA-binding protein complex which recognizes the core sequence 5'-CAC[GA]TG-3'. Antagonizes MYC transcriptional activity by competing for MAX and suppresses MYC dependent cell transformation. |
| Protein Interactions |
NOTCH2NL; KRTAP10-7; UBC; NFKB1; MAGEA11; MAX; SIN3A; SMC3; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-MXD3 (ARP30089_T100) antibody |
| Blocking Peptide |
For anti-MXD3 (ARP30089_T100) antibody is Catalog # AAP30089 (Previous Catalog # AAPH00265) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human MXD3 |
| Uniprot ID |
Q9BW11 |
| Protein Name |
Max dimerization protein 3 |
| Protein Accession # |
NP_112590 |
| Purification |
Protein A purified |
| Nucleotide Accession # |
NM_031300 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
MXD3 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Horse, Pig, Rabbit |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 93%; Dog: 86%; Horse: 93%; Human: 100%; Mouse: 85%; Pig: 86%; Rabbit: 86%; Rat: 93% |
| Image 1 | Transfected 293T
 | WB Suggested Anti-MXD3 Antibody Titration: 0.5ug/ml
ELISA Titer: 1:312500
Positive Control: Transfected 293T |
|
|
