TFAP2D Antibody - C-terminal region (ARP30084_T100)

Data Sheet
 
Product Number ARP30084_T100
Product Page www.avivasysbio.com/tfap2d-antibody-c-terminal-region-arp30084-t100.html
Name TFAP2D Antibody - C-terminal region (ARP30084_T100)
Protein Size (# AA) 452 amino acids
Molecular Weight 50kDa
NCBI Gene Id 83741
Host Rabbit
Clonality Polyclonal
Concentration 1.0 mg/ml
Gene Full Name Transcription factor AP-2 delta (activating enhancer binding protein 2 delta)
Alias Symbols TFAP2BL1, AP-2delta
Peptide Sequence Synthetic peptide located within the following region: LGSSRPTPILDLDIQRHLTHFSLITHGFGTPAICAALSTFQTVLSEMLNY
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Cheng,C., et al., (2002) Int. J. Biochem. Cell Biol. 34 (1), 78-86
Description of Target TFAP2D has significantly high homology to transcription factor AP-2 gene of human. It is highly expressed in adult thymus, prostate, small intestine, skeletal muscle, placenta, brain, and testis tissues
Protein Interactions UBC;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-TFAP2D (ARP30084_T100) antibody
Blocking Peptide For anti-TFAP2D (ARP30084_T100) antibody is Catalog # AAP30084 (Previous Catalog # AAPH00260)
Immunogen The immunogen is a synthetic peptide directed towards the C terminal region of human TFAP2D
Uniprot ID Q7Z6R9
Protein Name Transcription factor AP-2-delta
Protein Accession # NP_758438
Purification Protein A purified
Nucleotide Accession # NM_172238
Tested Species Reactivity Human
Gene Symbol TFAP2D
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100%
Image 1
Human Muscle
WB Suggested Anti-TFAP2D Antibody Titration: 2.5ug/ml
ELISA Titer: 1:312500
Positive Control: Human Muscle
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com