Product Number |
ARP30084_T100 |
Product Page |
www.avivasysbio.com/tfap2d-antibody-c-terminal-region-arp30084-t100.html |
Name |
TFAP2D Antibody - C-terminal region (ARP30084_T100) |
Protein Size (# AA) |
452 amino acids |
Molecular Weight |
50kDa |
NCBI Gene Id |
83741 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
1.0 mg/ml |
Gene Full Name |
Transcription factor AP-2 delta (activating enhancer binding protein 2 delta) |
Alias Symbols |
TFAP2BL1, AP-2delta |
Peptide Sequence |
Synthetic peptide located within the following region: LGSSRPTPILDLDIQRHLTHFSLITHGFGTPAICAALSTFQTVLSEMLNY |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Reference |
Cheng,C., et al., (2002) Int. J. Biochem. Cell Biol. 34 (1), 78-86 |
Description of Target |
TFAP2D has significantly high homology to transcription factor AP-2 gene of human. It is highly expressed in adult thymus, prostate, small intestine, skeletal muscle, placenta, brain, and testis tissues |
Protein Interactions |
UBC; |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-TFAP2D (ARP30084_T100) antibody |
Blocking Peptide |
For anti-TFAP2D (ARP30084_T100) antibody is Catalog # AAP30084 (Previous Catalog # AAPH00260) |
Immunogen |
The immunogen is a synthetic peptide directed towards the C terminal region of human TFAP2D |
Uniprot ID |
Q7Z6R9 |
Protein Name |
Transcription factor AP-2-delta |
Protein Accession # |
NP_758438 |
Purification |
Protein A purified |
Nucleotide Accession # |
NM_172238 |
Tested Species Reactivity |
Human |
Gene Symbol |
TFAP2D |
Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish |
Application |
WB |
Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100% |
Image 1 | Human Muscle
| WB Suggested Anti-TFAP2D Antibody Titration: 2.5ug/ml ELISA Titer: 1:312500 Positive Control: Human Muscle |
|
|