| Product Number |
ARP30068_T100 |
| Product Page |
www.avivasysbio.com/znf541-antibody-middle-region-arp30068-t100.html |
| Name |
ZNF541 Antibody - middle region (ARP30068_T100) |
| Protein Size (# AA) |
534 amino acids |
| Molecular Weight |
59kDa |
| NCBI Gene Id |
84215 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
1.0 mg/ml |
| Gene Full Name |
Zinc finger protein 541 |
| Peptide Sequence |
Synthetic peptide located within the following region: AGPPADPSKSKLTIFSRIQGGNIYRLPHPVKEENVAGRGNQQNGSPTDWT |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Ansorge,W., et al., (2004) Submitted (22-SEP-2004) MIPS Ingolstaedter Landstr.1 D-85764 Neuherberg GERMANY |
| Description of Target |
ZNF541 is a new candidate transcription factor |
| Protein Interactions |
UBC; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-ZNF541 (ARP30068_T100) antibody |
| Blocking Peptide |
For anti-ZNF541 (ARP30068_T100) antibody is Catalog # AAP30068 (Previous Catalog # AAPH00244) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human ZNF541 |
| Uniprot ID |
Q9H0D2-2 |
| Protein Name |
Zinc finger protein 541 |
| Protein Accession # |
CAD38720 |
| Purification |
Protein A purified |
| Nucleotide Accession # |
NM_001101419 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
ZNF541 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 93%; Dog: 93%; Guinea Pig: 93%; Horse: 86%; Human: 100%; Mouse: 86%; Rat: 86% |
| Image 1 | Human Jurkat
 | WB Suggested Anti-ZNF541 Antibody Titration: 1.25ug/ml
ELISA Titer: 1:1562500
Positive Control: Jurkat cell lysate |
|
|
