| Product Number |
ARP30062_P050 |
| Product Page |
www.avivasysbio.com/hps3-antibody-n-terminal-region-arp30062-p050.html |
| Product Name |
Hps3 antibody - N-terminal region (ARP30062_P050) |
| Size |
100 ul |
| Gene Symbol |
Hps3 |
| Alias Symbols |
Hps3 |
| Protein Size (# AA) |
1002 amino acids |
| Molecular Weight |
113kDa |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| NCBI Gene Id |
310288 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml |
| Official Gene Full Name |
Hermansky-Pudlak syndrome 3 homolog (human) |
| Description |
This is a rabbit polyclonal antibody against Hps3. It was validated on Western Blot by Aviva Systems Biology. At Aviva Systems Biology we manufacture rabbit polyclonal antibodies on a large scale (200-1000 products/month) of high throughput manner. Our antibodies are peptide based and protein family oriented. We usually provide antibodies covering each member of a whole protein family of your interest. We also use our best efforts to provide you antibodies recognize various epitopes of a target protein. For availability of antibody needed for your experiment, please inquire (info@avivasysbio.com). |
| Peptide Sequence |
Synthetic peptide located within the following region: LSRQRCTFSTLGRVLRMAYSEAGDYLVAIEEKNKTVFLRAYVNWRSKRND |
| Description of Target |
The function of Hps3 remains unknown. |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Lead Time |
Domestic: within 1-2 days delivery International: 1-2 days |
| Blocking Peptide |
For anti-Hps3 (ARP30062_P050) antibody is Catalog # AAP30062 (Previous Catalog # AAPP23905) |
| Immunogen |
The immunogen is a synthetic peptide corresponding to a region of Rat |
| Complete computational species homology data |
Anti-Hps3 (ARP30062_P050) |
| Tissue Tool |
Find tissues and cell lines supported by DNA array analysis to express Hps3.  |
| Protein Accession # |
NP_001101134 |
| Purification |
Affinity Purified |
| RNA Seq |
Find tissues and cell lines supported by RNA-seq analysis to express Hps3.  |
| Nucleotide Accession # |
NM_001107664 |
| Replacement Item |
This antibody may replace item sc-33375 from Santa Cruz Biotechnology. |
| Conjugation Options |
ARP30062_P050-FITC Conjugated ARP30062_P050-HRP Conjugated ARP30062_P050-Biotin Conjugated |
| CB Replacement |
sc-33375 |
| Species Reactivity |
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 93%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 85% |
| Image 1 | Rat Brain
 | WB Suggested Anti-Hps3 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Rat Brain |
|
