website statistics
Product Datasheet: ARP30062_P050 - Hps3 antibody - N-terminal region (ARP30062_P050) - Aviva Systems Biology
 
Hps3 antibody - N-terminal region (ARP30062_P050)
Data Sheet
 
Product Number ARP30062_P050
Product Page www.avivasysbio.com/hps3-antibody-n-terminal-region-arp30062-p050.html
Product Name Hps3 antibody - N-terminal region (ARP30062_P050)
Size 100 ul
Gene Symbol Hps3
Alias Symbols Hps3
Protein Size (# AA) 1002 amino acids
Molecular Weight 113kDa
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
NCBI Gene Id 310288
Host Rabbit
Clonality Polyclonal
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Official Gene Full Name Hermansky-Pudlak syndrome 3 homolog (human)
Description This is a rabbit polyclonal antibody against Hps3. It was validated on Western Blot by Aviva Systems Biology. At Aviva Systems Biology we manufacture rabbit polyclonal antibodies on a large scale (200-1000 products/month) of high throughput manner. Our antibodies are peptide based and protein family oriented. We usually provide antibodies covering each member of a whole protein family of your interest. We also use our best efforts to provide you antibodies recognize various epitopes of a target protein. For availability of antibody needed for your experiment, please inquire (info@avivasysbio.com).
Peptide Sequence Synthetic peptide located within the following region: LSRQRCTFSTLGRVLRMAYSEAGDYLVAIEEKNKTVFLRAYVNWRSKRND
Description of Target The function of Hps3 remains unknown.
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Lead Time Domestic: within 1-2 days delivery International: 1-2 days
Blocking Peptide For anti-Hps3 (ARP30062_P050) antibody is Catalog # AAP30062 (Previous Catalog # AAPP23905)
Immunogen The immunogen is a synthetic peptide corresponding to a region of Rat
Complete computational species homology data Anti-Hps3 (ARP30062_P050)
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express Hps3.
Protein Accession # NP_001101134
Purification Affinity Purified
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express Hps3.
Nucleotide Accession # NM_001107664
Replacement Item This antibody may replace item sc-33375 from Santa Cruz Biotechnology.
Conjugation Options

ARP30062_P050-FITC Conjugated

ARP30062_P050-HRP Conjugated

ARP30062_P050-Biotin Conjugated

CB Replacement sc-33375
Species Reactivity Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 93%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 85%
Image 1
Rat Brain
WB Suggested Anti-Hps3 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Rat Brain
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
5754 Pacific Center Blvd., Suite 201 San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com