ZNF512 Antibody - middle region (ARP30060_P050)

Data Sheet
 
Product Number ARP30060_P050
Product Page www.avivasysbio.com/znf512-antibody-middle-region-arp30060-p050.html
Name ZNF512 Antibody - middle region (ARP30060_P050)
Protein Size (# AA) 567 amino acids
Molecular Weight 65kDa
NCBI Gene Id 84450
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name Zinc finger protein 512
Peptide Sequence Synthetic peptide located within the following region: QLRSLAGMKYHVMANHNSLPILKAGDEIDEPSERERLRTVLKRLGKLRCM
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Ota,T., et al., (2004) Nat. Genet. 36 (1), 40-45
Description of Target ZNF512 is a new candidate transcription factor.
Protein Interactions RNF2; SIRT7; UBC; tat;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-ZNF512 (ARP30060_P050) antibody
Blocking Peptide For anti-ZNF512 (ARP30060_P050) antibody is Catalog # AAP30060 (Previous Catalog # AAPH00236)
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human ZNF512
Uniprot ID Q96ME7
Protein Name Zinc finger protein 512
Protein Accession # NP_115810
Purification Affinity Purified
Nucleotide Accession # NM_032434
Tested Species Reactivity Human
Gene Symbol ZNF512
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 93%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 93%; Rabbit: 93%; Rat: 93%
Image 1
Human Brain
WB Suggested Anti-ZNF512 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Human brain
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com