Product Number |
ARP30060_P050 |
Product Page |
www.avivasysbio.com/znf512-antibody-middle-region-arp30060-p050.html |
Name |
ZNF512 Antibody - middle region (ARP30060_P050) |
Protein Size (# AA) |
567 amino acids |
Molecular Weight |
65kDa |
NCBI Gene Id |
84450 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
0.5 mg/ml |
Gene Full Name |
Zinc finger protein 512 |
Peptide Sequence |
Synthetic peptide located within the following region: QLRSLAGMKYHVMANHNSLPILKAGDEIDEPSERERLRTVLKRLGKLRCM |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Reference |
Ota,T., et al., (2004) Nat. Genet. 36 (1), 40-45 |
Description of Target |
ZNF512 is a new candidate transcription factor. |
Protein Interactions |
RNF2; SIRT7; UBC; tat; |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-ZNF512 (ARP30060_P050) antibody |
Blocking Peptide |
For anti-ZNF512 (ARP30060_P050) antibody is Catalog # AAP30060 (Previous Catalog # AAPH00236) |
Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human ZNF512 |
Uniprot ID |
Q96ME7 |
Protein Name |
Zinc finger protein 512 |
Protein Accession # |
NP_115810 |
Purification |
Affinity Purified |
Nucleotide Accession # |
NM_032434 |
Tested Species Reactivity |
Human |
Gene Symbol |
ZNF512 |
Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit |
Application |
WB |
Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 93%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 93%; Rabbit: 93%; Rat: 93% |
Image 1 | Human Brain
| WB Suggested Anti-ZNF512 Antibody Titration: 0.2-1 ug/ml ELISA Titer: 1:312500 Positive Control: Human brain |
|
|