FOXN1 Antibody - N-terminal region (ARP30053_T100)

Data Sheet
 
Product Number ARP30053_T100
Product Page www.avivasysbio.com/foxn1-antibody-n-terminal-region-arp30053-t100.html
Name FOXN1 Antibody - N-terminal region (ARP30053_T100)
Protein Size (# AA) 648 amino acids
Molecular Weight 69kDa
NCBI Gene Id 8456
Host Rabbit
Clonality Polyclonal
Concentration 1.0 mg/ml
Gene Full Name Forkhead box N1
Alias Symbols WHN, RONU, TLIND, FKHL20, TIDAND
Peptide Sequence Synthetic peptide located within the following region: FVSDGPPERTPSLPPHSPRIASPGPEQVQGHCPAGPGPGPFRLSPSDKYP
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Mecklenburg,L., et al., (2005) Exp. Dermatol. 14 (11), 797-810
Description of Target Mutations in the winged-helix transcription factor gene at the nude locus in mice and rats produce the pleiotropic phenotype of hairlessness and athymia, resulting in a severely compromised immune system. This gene is orthologous to the mouse and rat genes and encodes a similar DNA-binding transcription factor that is thought to regulate keratin gene expression. A mutation in this gene has been correlated with T-cell immunodeficiency, the skin disorder congenital alopecia, and nail dystrophy. Alternative splicing in the 5' UTR of this gene has been observed.
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-FOXN1 (ARP30053_T100) antibody
Blocking Peptide For anti-FOXN1 (ARP30053_T100) antibody is Catalog # AAP30053 (Previous Catalog # AAPH00229)
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human FOXN1
Uniprot ID O15353
Protein Name Forkhead box protein N1
Sample Type Confirmation

FOXN1 is supported by BioGPS gene expression data to be expressed in Raji

Protein Accession # NP_003584
Purification Protein A purified
Nucleotide Accession # NM_003593
Tested Species Reactivity Human
Gene Symbol FOXN1
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 93%; Dog: 79%; Guinea Pig: 86%; Horse: 93%; Human: 100%; Mouse: 86%; Pig: 93%; Rabbit: 93%; Rat: 93%
Image 1
Human Raji
WB Suggested Anti-FOXN1 Antibody Titration: 5.0ug/ml
ELISA Titer: 1:1562500
Positive Control: Raji cell lysateFOXN1 is supported by BioGPS gene expression data to be expressed in Raji
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com