Product Number |
ARP30053_T100 |
Product Page |
www.avivasysbio.com/foxn1-antibody-n-terminal-region-arp30053-t100.html |
Name |
FOXN1 Antibody - N-terminal region (ARP30053_T100) |
Protein Size (# AA) |
648 amino acids |
Molecular Weight |
69kDa |
NCBI Gene Id |
8456 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
1.0 mg/ml |
Gene Full Name |
Forkhead box N1 |
Alias Symbols |
WHN, RONU, TLIND, FKHL20, TIDAND |
Peptide Sequence |
Synthetic peptide located within the following region: FVSDGPPERTPSLPPHSPRIASPGPEQVQGHCPAGPGPGPFRLSPSDKYP |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Reference |
Mecklenburg,L., et al., (2005) Exp. Dermatol. 14 (11), 797-810 |
Description of Target |
Mutations in the winged-helix transcription factor gene at the nude locus in mice and rats produce the pleiotropic phenotype of hairlessness and athymia, resulting in a severely compromised immune system. This gene is orthologous to the mouse and rat genes and encodes a similar DNA-binding transcription factor that is thought to regulate keratin gene expression. A mutation in this gene has been correlated with T-cell immunodeficiency, the skin disorder congenital alopecia, and nail dystrophy. Alternative splicing in the 5' UTR of this gene has been observed. |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-FOXN1 (ARP30053_T100) antibody |
Blocking Peptide |
For anti-FOXN1 (ARP30053_T100) antibody is Catalog # AAP30053 (Previous Catalog # AAPH00229) |
Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human FOXN1 |
Uniprot ID |
O15353 |
Protein Name |
Forkhead box protein N1 |
Sample Type Confirmation |
FOXN1 is supported by BioGPS gene expression data to be expressed in Raji |
Protein Accession # |
NP_003584 |
Purification |
Protein A purified |
Nucleotide Accession # |
NM_003593 |
Tested Species Reactivity |
Human |
Gene Symbol |
FOXN1 |
Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit |
Application |
WB |
Predicted Homology Based on Immunogen Sequence |
Cow: 93%; Dog: 79%; Guinea Pig: 86%; Horse: 93%; Human: 100%; Mouse: 86%; Pig: 93%; Rabbit: 93%; Rat: 93% |
Image 1 | Human Raji
| WB Suggested Anti-FOXN1 Antibody Titration: 5.0ug/ml ELISA Titer: 1:1562500 Positive Control: Raji cell lysateFOXN1 is supported by BioGPS gene expression data to be expressed in Raji |
|
|