KLF11 Antibody - N-terminal region (ARP30042_T100)

Data Sheet
 
Product Number ARP30042_T100
Product Page www.avivasysbio.com/klf11-antibody-n-terminal-region-arp30042-t100.html
Name KLF11 Antibody - N-terminal region (ARP30042_T100)
Protein Size (# AA) 512 amino acids
Molecular Weight 55kDa
NCBI Gene Id 8462
Host Rabbit
Clonality Polyclonal
Concentration 1.0 mg/ml
Gene Full Name Kruppel-like factor 11
Alias Symbols FKLF, FKLF1, MODY7, TIEG2, Tieg3
Peptide Sequence Synthetic peptide located within the following region: SQKGDLLRIRPLTPVSDSGDVTTTVHMDAATPELPKDFHSLSTLCITPPQ
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Neve,B., (2005) Proc. Natl. Acad. Sci. U.S.A. 102 (13), 4807-4812
Description of Target KLF11 (TIEG2) is a pancreas-enriched transcription factor that has elicited significant attention because of its role as negative regulator of exocrine cell growth in vitro and in vivo. It plays a role in the regulation of pancreatic beta cell physiology, and its variants may contribute to the development of diabetes.
Protein Interactions APPBP2; TXNDC9; APH1A; TIMM13; YWHAZ; CLU; SIN3A; MAPK1; ATXN1; CBX5; CBX3; CBX1; EP300; ELAVL1; UBC; HDAC1;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-KLF11 (ARP30042_T100) antibody
Blocking Peptide For anti-KLF11 (ARP30042_T100) antibody is Catalog # AAP30042 (Previous Catalog # AAPH00218)
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human KLF11
Uniprot ID O14901
Protein Name Krueppel-like factor 11
Protein Accession # NP_003588
Purification Protein A purified
Nucleotide Accession # NM_003597
Tested Species Reactivity Human
Gene Symbol KLF11
Predicted Species Reactivity Human, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 93%; Dog: 92%; Guinea Pig: 86%; Horse: 93%; Human: 100%; Pig: 93%; Rabbit: 77%; Rat: 90%
Image 1
Transfected 293T
WB Suggested Anti-KLF11 Antibody Titration: 1.25ug/ml
ELISA Titer: 1:1562500
Positive Control: Transfected 293T
Image 2
Human RPMI 8226 Whole Cell
Host: Rabbit
Target Name: KLF11
Sample Tissue: Human RPMI 8226 Whole Cell
Antibody Dilution: 7ug/m
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com