SUPT3H Antibody - N-terminal region (ARP30038_T100)

Data Sheet
 
Product Number ARP30038_T100
Product Page www.avivasysbio.com/supt3h-antibody-n-terminal-region-arp30038-t100.html
Name SUPT3H Antibody - N-terminal region (ARP30038_T100)
Protein Size (# AA) 317 amino acids
Molecular Weight 36kDa
NCBI Gene Id 8464
Host Rabbit
Clonality Polyclonal
Concentration 1.0 mg/ml
Gene Full Name Suppressor of Ty 3 homolog (S. cerevisiae)
Alias Symbols SPT3, SPT3L
Peptide Sequence Synthetic peptide located within the following region: MRKDKKKLRRLLKYMFIRDYKSKIVKGIDEDDLLEDKLSGSNNANKRQKI
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Yu,J., et al., (1998) Genomics 53 (1), 90-96
Description of Target SUPT3H is a component of the multiprotein SPT-ADA-GCN5 acetyltransferase (SAGA) complex that integrates proteins with transcription coactivator/adaptor functions (ADAs and GCN5), histone acetyltransferase activity (GCN5), and core promoter-selective functions (SPTs) involving interactions with the TATA-binding protein (TBP).
Protein Interactions KAT2B; TADA1; CCDC101; SAP130; TADA3; SUPT7L; TRRAP; TCF3; TADA2A; KAT2A; TADA2B; TAF12; SUMO2; PYGO2; MED16; MED13; MED12; MED17; TAF10; TAF9; MED1; MYC; TP53; ATXN7; USP22; ATXN7L3; TAF5L; SF3B3; TAF6L; DDB2; DDB1; TAF5; TAF4;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-SUPT3H (ARP30038_T100) antibody
Blocking Peptide For anti-SUPT3H (ARP30038_T100) antibody is Catalog # AAP30038 (Previous Catalog # AAPH00214)
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human SUPT3H
Uniprot ID O75486
Protein Name Transcription initiation protein SPT3 homolog
Sample Type Confirmation

SUPT3H is supported by BioGPS gene expression data to be expressed in HepG2

Protein Accession # NP_003590
Purification Protein A purified
Nucleotide Accession # NM_003599
Tested Species Reactivity Human
Gene Symbol SUPT3H
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Goat, Guinea Pig, Horse, Pig, Rabbit
Application IHC, WB
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Goat: 100%; Guinea Pig: 86%; Horse: 100%; Human: 100%; Mouse: 93%; Pig: 100%; Rabbit: 86%; Rat: 93%
Image 1
Human Liver
Rabbit Anti-SUPT3H Antibody
Catalog Number: ARP30038
Paraffin Embedded Tissue: Human Liver
Cellular Data: Hepatocytes
Antibody Concentration: 4.0-8.0 ug/ml
Magnification: 400X
Image 2
Human HepG2
WB Suggested Anti-SUPT3H Antibody Titration: 0.4ug/ml
ELISA Titer: 1:1562500
Positive Control: HepG2 cell lysateSUPT3H is supported by BioGPS gene expression data to be expressed in HepG2
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com