Product Number |
ARP30018_P050 |
Product Page |
www.avivasysbio.com/znf499-antibody-middle-region-arp30018-p050.html |
Name |
ZNF499 Antibody - middle region (ARP30018_P050) |
Protein Size (# AA) |
511 amino acids |
Molecular Weight |
54kDa |
NCBI Gene Id |
84878 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
0.5 mg/ml |
Gene Full Name |
Zinc finger and BTB domain containing 45 |
Alias Symbols |
ZNF499 |
Peptide Sequence |
Synthetic peptide located within the following region: CEEPPAPTGLADYSGAGRDFLRGAGSAEDVFPDSYVSTWHDEDGAVPEGC |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Reference |
Ota,T., et al., (2004) Nat. Genet. 36 (1), 40-45 |
Description of Target |
The ZNF499 gene is located on chromosome 19 and encodes a protein with unknown function. |
Protein Interactions |
MED31; |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-ZBTB45 (ARP30018_P050) antibody |
Blocking Peptide |
For anti-ZBTB45 (ARP30018_P050) antibody is Catalog # AAP30018 (Previous Catalog # AAPH00118) |
Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human ZNF499 |
Uniprot ID |
Q96K62 |
Protein Name |
Zinc finger and BTB domain-containing protein 45 |
Protein Accession # |
NP_116181 |
Purification |
Affinity Purified |
Nucleotide Accession # |
NM_032792 |
Tested Species Reactivity |
Human |
Gene Symbol |
ZBTB45 |
Predicted Species Reactivity |
Human, Mouse, Rat, Dog, Guinea Pig, Rabbit |
Application |
WB |
Predicted Homology Based on Immunogen Sequence |
Dog: 79%; Guinea Pig: 79%; Human: 100%; Mouse: 79%; Rabbit: 86%; Rat: 79% |
Image 1 | Human Lung
| WB Suggested Anti-ZNF499 Antibody Titration: 0.015ug/ml ELISA Titer: 1:312500 Positive Control: Human Lung |
|
|