Product Number |
ARP30013_T100 |
Product Page |
www.avivasysbio.com/znf341-antibody-n-terminal-region-arp30013-t100.html |
Name |
ZNF341 Antibody - N-terminal region (ARP30013_T100) |
Protein Size (# AA) |
847 amino acids |
Molecular Weight |
92kDa |
NCBI Gene Id |
84905 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
1.0 mg/ml |
Gene Full Name |
Zinc finger protein 341 |
Alias Symbols |
HIES3 |
Peptide Sequence |
Synthetic peptide located within the following region: EGMDNQTVLAVQSLLDGQGAVPDPTGQSVNAPPAIQPLDDEDVFLCGKCK |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Reference |
Ota,T., et al., (2004) Nat. Genet. 36 (1), 40-45 |
Description of Target |
Zinc Finger Protein 341 is a new candidate transcription factor. |
Protein Interactions |
CENPP; KLHL38; WDYHV1; MAGEB4; CSTF2; ARNT2; PRPF40A; |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-ZNF341 (ARP30013_T100) antibody |
Blocking Peptide |
For anti-ZNF341 (ARP30013_T100) antibody is Catalog # AAP30013 (Previous Catalog # AAPH00113) |
Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human ZNF341 |
Uniprot ID |
Q9BYN7 |
Protein Name |
Zinc finger protein 341 |
Protein Accession # |
NP_116208 |
Purification |
Protein A purified |
Nucleotide Accession # |
NM_032819 |
Tested Species Reactivity |
Human |
Gene Symbol |
ZNF341 |
Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit |
Application |
WB |
Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 92%; Guinea Pig: 92%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 92%; Rat: 92% |
Image 1 | Human HepG2
| WB Suggested Anti-ZNF341 Antibody Titration: 2.0ug/ml ELISA Titer: 1:62500 Positive Control: HepG2 cell lysate |
|
|