ZNF341 Antibody - N-terminal region (ARP30013_T100)

• Product Number: ARP30013_T100
• Name: ZNF341 Antibody - N-terminal region (ARP30013_T100)
• Protein Size (# AA): 847 amino acids
• Molecular Weight: 92kDa
• NCBI Gene Id: 84905
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 1.0 mg/ml
• Gene Full Name: Zinc finger protein 341
• Alias Symbols: HIES3
• Peptide Sequence: Synthetic peptide located within the following region: EGMDNQTVLAVQSLLDGQGAVPDPTGQSVNAPPAIQPLDDEDVFLCGKCK
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reference: Ota,T., et al., (2004) Nat. Genet. 36 (1), 40-45
• Description of Target: Zinc Finger Protein 341 is a new candidate transcription factor.
• Protein Interactions: CENPP; KLHL38; WDYHV1; MAGEB4; CSTF2; ARNT2; PRPF40A;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Blocking Peptide: For anti-ZNF341 (ARP30013_T100) antibody is Catalog # AAP30013 (Previous Catalog # AAPH00113)
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human ZNF341
• Uniprot ID: Q9BYN7
• Protein Name: Zinc finger protein 341
• Protein Accession #: NP_116208
• Purification: Protein A purified
• Nucleotide Accession #: NM_032819
• Tested Species Reactivity: Human
• Gene Symbol: ZNF341
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit
• Application: WB
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 92%; Guinea Pig: 92%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 92%; Rat: 92%
• Image 1: Human HepG2
  
  WB Suggested Anti-ZNF341 Antibody Titration: 2.0ug/ml
  ELISA Titer: 1:62500
  Positive Control: HepG2 cell lysate