Sku |
AAPP47878 |
Price |
$99.00 |
Name |
PCBD2 Peptide - C-terminal region (AAPP47878) |
Purchase info |
To purchase this peptide:
- Copy peptide sku
- Click on this link
- Paste into field "Peptide Sku"
|
Size |
100ug |
Gene |
PCBD2 |
Alias symbols |
DCOH2, DCOHM, PHS2 |
Gene id |
84105 |
Description of target |
PCBD2 is involved in tetrahydrobiopterin biosynthesis. It seems to both prevent the formation of 7-pterins and accelerate the formation of quinonoid-BH2. |
Swissprot id |
Q9H0N5 |
Protein accession num |
NP_115527 |
Nucleotide accession num |
NM_032151 |
Protein size |
130 amino acids |
Molecular weight |
14kDa |
Species reactivity |
Human |
Application |
WB |
Peptide sequence |
NQAFGFMSRVALQAEKMNHHPEWFNVYNKVQITLTSHDCGELTKKDVKLA |
Partner proteins |
MET,PCBD2,AATF,ASCC2,BRF1,C1D,CDC5L,CENPK,CHAF1A,GTF2E1,HES4,HNF1A,IRF2BP1,KCNIP3,MED21,MED30,MED4,MED7,PBXIP1,PCBD1,PHF14,PML,RUNX1T1,SNW1,SSX3,SSX5,STAT3,TAL2,TGIF2LY,XBP1,ZZZ3 |
Quality control |
The peptide is characterized by mass spectroscopy |
Key reference |
N/A |
Description |
This is a synthetic peptide designed for use in combination with anti-PCBD2 Antibody (ARP60484_P050), made by Aviva Systems Biology. It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings. There is no guarantee for its use in other applications. Please inquire for more details. |
Product format |
Lyophilized powder |
Reconstitution and storage |
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles. |
Lead time |
Domestic: within 24 hours delivery International: 3-5 business days |
Protocol |
|
Tips |
See our General FAQ page. |
Availability |
In Stock |