| Sku |
AAP59608 |
| Old sku |
AAPP46308 |
| Price |
$99.00 |
| Name |
MANF Peptide - C-terminal region (AAP59608) |
| Purchase info |
To purchase this peptide:
- Copy peptide sku
- Click on this link
- Paste into field "Peptide Sku"
|
| Size |
100ug |
| Gene |
MANF |
| Alias symbols |
ARMET, ARP, MGC142148, MGC142150 |
| Gene id |
7873 |
| Description of target |
MANF is localized in the endoplasmic reticulum (ER) and golgi, and is also secreted. Reducing expression of MANF gene increases susceptibility to ER stress-induced death and promotes cell proliferation. The protein was initially thought to be longer at the N-terminus and to contain an arginine-rich region but transcribed evidence indicates a smaller open reading frame that does not encode the arginine tract. The presence of polymorphisms in the arginine-rich region, including a specific mutation that changes the previously numbered codon 50 from ATG to AGG, have been reported in a variety of solid tumors; however, these polymorphisms were later shown to exist in normal tissues and are thus not tumor-related. |
| Swissprot id |
A8K878 |
| Protein accession num |
NP_006001 |
| Nucleotide accession num |
NM_006010 |
| Protein size |
185 amino acids |
| Molecular weight |
21kDa |
| Species reactivity |
Human |
| Application |
WB |
| Peptide sequence |
EKICEKLKKKDSQICELKYDKQIDLSTVDLKKLRVKELKKILDDWGETCK |
| Quality control |
The peptide is characterized by mass spectroscopy |
| Key reference |
N/A |
| Description |
This is a synthetic peptide designed for use in combination with anti-MANF Antibody (ARP59608_P050), made by Aviva Systems Biology. It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings. There is no guarantee for its use in other applications. Please inquire for more details. |
| Product format |
Lyophilized powder |
| Reconstitution and storage |
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles. |
| Lead time |
Domestic: within 24 hours delivery International: 3-5 business days |
| Protocol |
|
| Tips |
See our General FAQ page. |
| Availability |
In Stock |
