| Sku |
AAP56863 |
| Old sku |
AAPP44229 |
| Price |
$99.00 |
| Name |
NLK Peptide - middle region (AAP56863) |
| Purchase info |
To purchase this peptide:
- Copy peptide sku
- Click on this link
- Paste into field "Peptide Sku"
|
| Size |
100ug |
| Gene |
NLK |
| Alias symbols |
DKFZp761G1211, FLJ21033 |
| Gene id |
51701 |
| Description of target |
NLK has a role in cell fate determination, required for differentiation of bone marrow stromal cells. NLK acts downstream of MAP3K7 and HIPK2 to negatively regulate the canonical Wnt/beta-catenin signaling pathway and the phosphorylation and destruction of the MYB transcription factor. NLK may suppress a wide range of transcription factors by phosphorylation of the coactivator, CREBBP By similarity.NLK is involved in TGFbeta-mediated mesoderm induction, acting downstream of MAP3K7/TAK1 to phosphorylate STAT3. |
| Swissprot id |
Q9UBE8 |
| Protein accession num |
NP_057315 |
| Nucleotide accession num |
NM_016231 |
| Protein size |
527 amino acids |
| Molecular weight |
58kDa |
| Species reactivity |
Human |
| Application |
WB |
| Peptide sequence |
RLRYHTCMCKCCFSTSTGRVYTSDFEPVTNPKFDDTFEKNLSSVRQVKEI |
| Partner proteins |
ATXN1,CREBBP,HIPK2,LEF1,MYB,NLK,STAT3,CTNNB1,CUL1,FBXW4,FBXW5,LEF1,MYB,SKP2,TCF7L2,UBC |
| Quality control |
The peptide is characterized by mass spectroscopy |
| Key reference |
N/A |
| Description |
This is a synthetic peptide designed for use in combination with anti-NLK Antibody(ARP56863_P050), made by Aviva Systems Biology. It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings. There is no guarantee for its use in other applications. Please inquire for more details. |
| Product format |
Lyophilized powder |
| Reconstitution and storage |
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles. |
| Lead time |
Domestic: within 24 hours delivery International: 3-5 business days |
| Protocol |
|
| Tips |
See our General FAQ page. |
| Availability |
In Stock |
