| Sku |
AAP46852 |
| Old sku |
AAPP27648 |
| Price |
$99.00 |
| Name |
BACE2 Peptide - middle region (AAP46852) |
| Purchase info |
To purchase this peptide:
- Copy peptide sku
- Click on this link
- Paste into field "Peptide Sku"
|
| Size |
100ug |
| Gene |
BACE2 |
| Alias symbols |
AEPLC, ALP56, ASP1, ASP21, BAE2, CDA13, CEAP1, DRAP |
| Gene id |
25825 |
| Description of target |
Cerebral deposition of amyloid beta peptide is an early and critical feature of Alzheimer's disease and a frequent complication of Down syndrome. Amyloid beta peptide is generated by proteolytic cleavage of amyloid precursor protein by 2 proteases, one of which is the protein encoded by this gene. This gene localizes to the 'Down critical region' of chromosome 21. The encoded protein, a member of the peptidase A1 protein family, is a type I integral membrane glycoprotein and aspartic protease. Three transcript variants encoding different isoforms have been described for this gene. |
| Swissprot id |
Q9Y5Z0 |
| Protein accession num |
NP_620477 |
| Nucleotide accession num |
NM_138992 |
| Protein size |
396 amino acids |
| Molecular weight |
37kDa |
| Species reactivity |
Human |
| Application |
WB |
| Peptide sequence |
SLNLDCREYNADKAIVDSGTTLLRLPQKVFDAVVEAVARASLIPEFSDGF |
| Partner proteins |
APP,BACE2,GGA1,GGA2 |
| Quality control |
The peptide is characterized by mass spectroscopy |
| Key reference |
N/A |
| Description |
This is a synthetic peptide designed for use in combination with anti-BACE2 Antibody(ARP46852_P050), made by Aviva Systems Biology. It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings. There is no guarantee for its use in other applications. Please inquire for more details. |
| Product format |
Lyophilized powder |
| Reconstitution and storage |
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles. |
| Lead time |
Domestic: within 24 hours delivery International: 3-5 business days |
| Protocol |
|
| Tips |
See our General FAQ page. |
| Availability |
In Stock |
