| Sku |
AAP42161 |
| Old sku |
AAPS11910 |
| Price |
$99.00 |
| Name |
MAP3K14 Peptide - N-terminal region (AAP42161) |
| Purchase info |
To purchase this peptide:
- Copy peptide sku
- Click on this link
- Paste into field "Peptide Sku"
|
| Size |
100ug |
| Gene |
MAP3K14 |
| Alias symbols |
FTDCR1B, HS, HSNIK, NIK |
| Gene id |
9020 |
| Description of target |
This gene encodes mitogen-activated protein kinase kinase kinase 14, which is a serine/threonine protein-kinase. This kinase binds to TRAF2 and stimulates NF-kappaB activity. It shares sequence similarity with several other MAPKK kinases. It participates in an NF-kappaB-inducing signalling cascade common to receptors of the tumour-necrosis/nerve-growth factor (TNF/NGF) family and to the interleukin-1 type-I receptor. |
| Swissprot id |
Q99558 |
| Protein accession num |
NP_003945 |
| Nucleotide accession num |
NM_003954 |
| Protein size |
947 amino acids |
| Molecular weight |
104kDa |
| Species reactivity |
Human |
| Application |
WB |
| Peptide sequence |
SEAGPAAISIIAQAECENSQEFSPTFSERIFIAGSKQYSQSESLDQIPNN |
| Partner proteins |
CHUK,IKBKAP,IKBKB,TRAF1,TRAF2,TRAF3,TRAF5,TRAF6,ALPL,CASP8,CDC37,CHUK,EDAR,EGFR,FBL,GRB10,GRB14,GRB7,HSP90AA1,HSP90AB1,IKBKAP,IKBKB,IKBKG,MAP2K4,MAP3K14,MAP3K7,MAP3K8,MAPK3,NFKB2,PEBP1,PELI3,RIPK1,RPL30,RPL4,RPL5,RPL6,RPS11,RPS13,TRAF1,TRAF2,TRAF3,TRAF5,T |
| Quality control |
The peptide is characterized by mass spectroscopy |
| Key reference |
N/A |
| Description |
This is a synthetic peptide designed for use in combination with anti-MAP3K14 Antibody(ARP42161_P050), made by Aviva Systems Biology. It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings. There is no guarantee for its use in other applications. Please inquire for more details. |
| Product format |
Lyophilized powder |
| Reconstitution and storage |
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles. |
| Lead time |
Domestic: within 24 hours delivery International: 3-5 business days |
| Protocol |
|
| Tips |
See our General FAQ page. |
| Availability |
In Stock |
