| Sku |
AAP37033 |
| Old sku |
AAPP09231 |
| Price |
$99.00 |
| Name |
Dnmt1 Peptide - N-terminal region (AAP37033) |
| Purchase info |
To purchase this peptide:
- Copy peptide sku
- Click on this link
- Paste into field "Peptide Sku"
|
| Size |
100ug |
| Gene |
Dnmt1 |
| Alias symbols |
Cxxc9, Dnmt, Dnmt1o, MTase, Met-1, Met1, MommeD2, MCMT, m.MmuI |
| Gene id |
13433 |
| Description of target |
Dnmt1 methylates CpG residues.Dnmt1 preferentially methylates hemimethylated DNA. Dnmt1 associates with DNA replication sites in S phase maintaining the methylation pattern in the newly synthesized strand, that is essential for epigenetic inheritance.Dnmt1 associates with chromatin during G2 and M phases to maintain DNA methylation independently of replication. It is responsible for maintaining methylation patterns established in development. DNA methylation is coordinated with methylation of histones.Dnmt1 mediates transcriptional repression by direct binding to HDAC2. In association with DNMT3B and via the recruitment of CTCFL/BORIS, Dnmt1 is involved in activation of BAG1 gene expression by modulating dimethylation of promoter histone H3 at H3K4 and H3K9. |
| Swissprot id |
P13864 |
| Protein accession num |
NP_034196 |
| Nucleotide accession num |
NM_010066 |
| Protein size |
1619 amino acids |
| Molecular weight |
183kDa |
| Species reactivity |
Mouse |
| Application |
WB |
| Peptide sequence |
SSVATRRTTRQTTITAHFTKGPTKRKPKEESEEGNSAESAAEERDQDKKR |
| Partner proteins |
HDAC1 |
| Quality control |
The peptide is characterized by mass spectroscopy |
| Key reference |
N/A |
| Description |
This is a synthetic peptide designed for use in combination with anti-Dnmt1 Antibody(ARP37033_P050), made by Aviva Systems Biology. It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings. There is no guarantee for its use in other applications. Please inquire for more details. |
| Product format |
Lyophilized powder |
| Reconstitution and storage |
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles. |
| Lead time |
Domestic: within 24 hours delivery International: 3-5 business days |
| Protocol |
|
| Tips |
See our General FAQ page. |
| Availability |
In Stock |
