Pax8 Peptide - C-terminal region (AAP34180)

Data Sheet
 
Sku AAP34180
Old sku AAPP05442
Price $99.00
Name Pax8 Peptide - C-terminal region (AAP34180)
Purchase info To purchase this peptide:
  • Copy peptide sku
  • Click on this link
  • Paste into field "Peptide Sku"
Size 100ug
Gene Pax8
Alias symbols Pax-8
Gene id 18510
Description of target Pax8 is thought to encode a transcription factor. It may have a role in kidney cell differentiation. It may play a regulatory role in mammalian development.
Swissprot id Q00288
Protein accession num NP_035170
Nucleotide accession num NM_011040
Protein size 457 amino acids
Molecular weight 49kDa
Species reactivity Mouse
Application WB
Peptide sequence PPFNAFPHAASVYGQFTGQALLSGREMVGPTLPGYPPHIPTSGQGSYASS
Partner proteins Nkx2-1,Phf17
Quality control The peptide is characterized by mass spectroscopy
Key reference N/A
Description This is a synthetic peptide designed for use in combination with anti-Pax8 Antibody (ARP34180_P050), made by Aviva Systems Biology. It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings. There is no guarantee for its use in other applications. Please inquire for more details.
Product format Lyophilized powder
Reconstitution and storage Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles.
Lead time Domestic: within 24 hours delivery  International: 3-5 business days
Protocol
Tips

See our General FAQ page.

Availability In Stock
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com