S100b (S100 calcium binding protein B ) Blocking Peptide (the N terminal of S100b)(100ug)
Data Sheet
 
Sku AAP33872
Name S100b (S100 calcium binding protein B ) Blocking Peptide (the N terminal of S100b)(100ug)
Purchase info To purchase this peptide:
  • Copy peptide #
  • Click on this link
  • Paste into field "Peptide Number"
Size 100ug
Gene symbol S100b
Alias symbols MGC93559; S100P
Nucleotide accession num NM_013191
Protein accession num NP_037323
Swissprot id P04631
Protein size 92 amino acids
Molecular weight 10kDa
Species reactivity Rat, Human
Product format Lyophilized powder
Gene id 25742
Quality control The peptide is characterized by mass spectroscopy
Price 99
Lead time Domestic: within 24 hours delivery  International: 3-5 business days
Availability In Stock
Peptide sequence KLKKSELKELINNELSHFLEEIKEQEVVDKVMETLDEDGDGECDFQEFMA
Key reference N/A
Description This is a synthetic peptide designed for use in combination with anti-S100b Antibody (ARP33872_P050), made by Aviva Systems Biology. It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings. There is no guarantee for its use in other applications. Please inquire for more details.
Reconstitution and storage Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.
Description of target S100b binds GTPase activating protein IQGAP1; It may play a role in cell membrane rearrangement.
Protocol
Tips

See our General FAQ page.
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

This product is for Research Use Only. Not for diagnostic, human, or veterinary use.
Optimal conditions of its use should be determined by end users.

__________________________________________________________________________________________________________________________________________________________________

AVIVA SYSTEMS BIOLOGY
5754 Pacific Center Blvd., Suite 201 San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com