Hoxb9 Peptide - middle region (AAP31956)

Data Sheet
 
Sku AAP31956
Old sku AAPP02853
Price $99.00
Name Hoxb9 Peptide - middle region (AAP31956)
Purchase info To purchase this peptide:
  • Copy peptide sku
  • Click on this link
  • Paste into field "Peptide Sku"
Size 100ug
Gene Hoxb9
Gene id 287647
Description of target The function of this protein remains unknown.
Protein accession num NP_001093967
Nucleotide accession num NM_001100497
Protein size 250 amino acids
Molecular weight 27kDa
Species reactivity Rat
Application WB
Peptide sequence SEDAPPAKFPSGQYANPRQPGHAEHLDFPSCSFQPKAPVFGASWAPLSPH
Quality control The peptide is characterized by mass spectroscopy
Key reference N/A
Description This is a synthetic peptide designed for use in combination with anti-Hoxb9 Antibody (ARP31956_P050), made by Aviva Systems Biology. It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings. There is no guarantee for its use in other applications. Please inquire for more details.
Product format Lyophilized powder
Reconstitution and storage Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles.
Lead time Domestic: within 24 hours delivery  International: 3-5 business days
Protocol
Tips

See our General FAQ page.

Availability In Stock
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com