Sku |
AAP30627 |
Old sku |
AAPP01280 |
Price |
$99.00 |
Name |
FAS Peptide - middle region (AAP30627) |
Purchase info |
To purchase this peptide:
- Copy peptide sku
- Click on this link
- Paste into field "Peptide Sku"
|
Size |
100ug |
Gene |
FAS |
Alias symbols |
ALPS1A, APO-1, APT1, CD95, FAS1, FASTM, TNFRSF6 |
Gene id |
355 |
Description of target |
FAS is a member of the TNF-receptor superfamily. This receptor contains a death domain. It has been shown to play a central role in the physiological regulation of programmed cell death, and has been implicated in the pathogenesis of various malignancies and diseases of the immune system. The interaction of this receptor with its ligand allows the formation of a death-inducing signaling complex that includes Fas-associated death domain protein (FADD), caspase 8, and caspase 10. The autoproteolytic processing of the caspases in the complex triggers a downstream caspase cascade, and leads to apoptosis. This receptor has been also shown to activate NF-kappaB, MAPK3/ERK1, and MAPK8/JNK, and is found to be involved in transducing the proliferating signals in normal diploid fibroblast and T cells. At least eight alternatively spliced transcript variants encoding seven distinct isoforms have been described. The isoforms lacking the transmembrane domain may negatively regulate the apoptosis mediated by the full length isoform. |
Swissprot id |
P25445 |
Protein accession num |
NP_000034 |
Nucleotide accession num |
NM_000043 |
Protein size |
335 amino acids |
Molecular weight |
36kDa |
Species reactivity |
Human |
Application |
WB |
Peptide sequence |
KKEAYDTLIKDLKKANLCTLAEKIQTIILKDITSDSENSNFRNEIQSLV |
Partner proteins |
CTNNB1,KAT5,RUVBL2,TP63,SUMO1,ANK3,APAF1,BTK,C14orf1,C1orf103,CALM1,CASP8,CASP8AP2,CD47,CRMP1,DAXX,EEF1A1,EGFR,EZR,FADD,FAF1,FAIM2,FAS,FASLG,FBF1,FEM1B,FYN,HIPK3,LCK,MET,PDCD6,PRKCA,PTPN13,PTPN6,RAP1A,RIPK1,SUMO1,TNFSF13,TRADD,UBA7,UBE2I,ARHGDIA,BID,BRE,C |
Quality control |
The peptide is characterized by mass spectroscopy |
Key reference |
N/A |
Description |
This is a synthetic peptide designed for use in combination with anti-FAS Antibody(ARP30627_P050), made by Aviva Systems Biology. It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings. There is no guarantee for its use in other applications. Please inquire for more details. |
Product format |
Lyophilized powder |
Reconstitution and storage |
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles. |
Lead time |
Domestic: within 24 hours delivery International: 3-5 business days |
Protocol |
|
Tips |
See our General FAQ page. |
Availability |
In Stock |