FAS Peptide - middle region (AAP30627)

Data Sheet
 
Sku AAP30627
Old sku AAPP01280
Price $99.00
Name FAS Peptide - middle region (AAP30627)
Purchase info To purchase this peptide:
  • Copy peptide sku
  • Click on this link
  • Paste into field "Peptide Sku"
Size 100ug
Gene FAS
Alias symbols ALPS1A, APO-1, APT1, CD95, FAS1, FASTM, TNFRSF6
Gene id 355
Description of target FAS is a member of the TNF-receptor superfamily. This receptor contains a death domain. It has been shown to play a central role in the physiological regulation of programmed cell death, and has been implicated in the pathogenesis of various malignancies and diseases of the immune system. The interaction of this receptor with its ligand allows the formation of a death-inducing signaling complex that includes Fas-associated death domain protein (FADD), caspase 8, and caspase 10. The autoproteolytic processing of the caspases in the complex triggers a downstream caspase cascade, and leads to apoptosis. This receptor has been also shown to activate NF-kappaB, MAPK3/ERK1, and MAPK8/JNK, and is found to be involved in transducing the proliferating signals in normal diploid fibroblast and T cells. At least eight alternatively spliced transcript variants encoding seven distinct isoforms have been described. The isoforms lacking the transmembrane domain may negatively regulate the apoptosis mediated by the full length isoform.
Swissprot id P25445
Protein accession num NP_000034
Nucleotide accession num NM_000043
Protein size 335 amino acids
Molecular weight 36kDa
Species reactivity Human
Application WB
Peptide sequence KKEAYDTLIKDLKKANLCTLAEKIQTIILKDITSDSENSNFRNEIQSLV
Partner proteins CTNNB1,KAT5,RUVBL2,TP63,SUMO1,ANK3,APAF1,BTK,C14orf1,C1orf103,CALM1,CASP8,CASP8AP2,CD47,CRMP1,DAXX,EEF1A1,EGFR,EZR,FADD,FAF1,FAIM2,FAS,FASLG,FBF1,FEM1B,FYN,HIPK3,LCK,MET,PDCD6,PRKCA,PTPN13,PTPN6,RAP1A,RIPK1,SUMO1,TNFSF13,TRADD,UBA7,UBE2I,ARHGDIA,BID,BRE,C
Quality control The peptide is characterized by mass spectroscopy
Key reference N/A
Description This is a synthetic peptide designed for use in combination with anti-FAS Antibody(ARP30627_P050), made by Aviva Systems Biology. It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings. There is no guarantee for its use in other applications. Please inquire for more details.
Product format Lyophilized powder
Reconstitution and storage Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles.
Lead time Domestic: within 24 hours delivery  International: 3-5 business days
Protocol
Tips

See our General FAQ page.

Availability In Stock
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com