Sku |
AAP30183 |
Price |
$99.00 |
Name |
TRAP1 Peptide - N-terminal region (AAP30183) |
Purchase info |
To purchase this peptide:
- Copy peptide sku
- Click on this link
- Paste into field "Peptide Sku"
|
Size |
100ug |
Gene |
TRAP1 |
Alias symbols |
HSP75, HSP90L |
Gene id |
10131 |
Description of target |
Suppression of the expression of TRAP1 in mitochondria might play an important role in the induction of apoptosis caused via formation of ROS. |
Swissprot id |
Q12931 |
Protein accession num |
NP_057376 |
Nucleotide accession num |
NM_016292 |
Protein size |
704 amino acids |
Molecular weight |
80kDa |
Species reactivity |
Human |
Application |
WB |
Peptide sequence |
RRTTAQLGPRRNPAWSLQAGRLFSTQTAEDKEEPLHSIISSTESVQGSTS |
Quality control |
The peptide is characterized by mass spectroscopy |
Key reference |
N/A |
Description |
This is a synthetic peptide designed for use in combination with anti-TRAP1 Antibody (ARP30183_P050), made by Aviva Systems Biology. It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings. There is no guarantee for its use in other applications. Please inquire for more details. |
Product format |
Lyophilized powder |
Reconstitution and storage |
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles. |
Lead time |
Domestic: within 24 hours delivery International: 3-5 business days |
Protocol |
|
Tips |
See our General FAQ page. |
Availability |
In Stock |