SAMD4A Antibody - middle region (ARP53707_P050)

Catalog No: ARP53707_P050

WB Suggested Anti-SAMD4A Antibody Titration: 0.2-1 ug/ml
Positive Control: Human Liver

Host: Rabbit
Target Name: SAMD4A
Sample Type: Human Fetal Brain
Antibody Dilution: 1.0ug/ml

Host: Rabbit
Target Name: SAMD4A
Sample Type: Human Fetal Liver
Antibody Dilution: 1.0ug/ml

Host: Rabbit
Target Name: SAMD4A
Sample Tissue: Human HT1080 Whole Cell
Antibody Dilution: 1ug/ml

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human SAMD4A
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 92%
• Peptide Sequence: Synthetic peptide located within the following region: LKSLRLHKYAALFSQMTYEEMMALTECQLEAQNVTKGARHKIVISIQKLK
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-SAMD4A (ARP53707_P050) antibody is Catalog # AAP53707 (Previous Catalog # AAPS33205)
• Reference: Baez,M.V. (2005) J. Biol. Chem. 280 (52), 43131-43140

Target Info

• Gene Symbol: SAMD4A
• Gene Full Name: Sterile alpha motif domain containing 4A
• Alias Symbols: SMG, SMGA, SAMD4, SMAUG, SMAUG1
• NCBI Gene Id: 23034
• Protein Name: Protein Smaug homolog 1
• Description of Target: Sterile alpha motifs (SAMs) in proteins such as SAMD4A are part of an RNA-binding domain that functions as a posttranscriptional regulator by binding to an RNA sequence motif known as the Smaug recognition element, which was named after the Drosophila Smaug protein.Sterile alpha motifs (SAMs) in proteins such as SAMD4A are part of an RNA-binding domain that functions as a posttranscriptional regulator by binding to an RNA sequence motif known as the Smaug recognition element, which was named after the Drosophila Smaug protein (Baez and Boccaccio, 2005 [PubMed 16221671]).[supplied by OMIM].
• Uniprot ID: Q9UPU9
• Protein Accession #: NP_056404
• Nucleotide Accession #: NM_015589
• Protein Size (# AA): 717
• Molecular Weight: 79kDa
• Protein Interactions: NUTM1; GOLGA2; YWHAB; YWHAG;