RPE65 Antibody - middle region (ARP74186_P050)

Catalog No: ARP74186_P050

Host: Rabbit
Target Name: RPE65
Sample Type: 293T Whole Cell lysates
Antibody Dilution: 1.0ug/ml

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of Human RPE65
• Purification: Affinity Purified
• Peptide Sequence: Synthetic peptide located within the following region: LFKFLSSWSLWGANYMDCFESNETMGVWLHIADKKRKKYLNNKYRTSPFN
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-RPE65 (ARP74186_P050) antibody is Catalog # AAP74186

Target Info

• Gene Symbol: RPE65
• Alias Symbols: p63, BCO3, LCA2, RP20, rd12, mRPE65, sRPE65
• NCBI Gene Id: 6121
• Description of Target: This gene encodes a protein which is located in the retinal pigment epithelium and is involved in the production of 11-cis retinal and in visual pigment regeneration. There are two forms of this protein, a soluble form called sRPE65, and a palmitoylated, membrane-bound form known as mRPE65. mRPE65 serves as the palmitoyl donor for lecithin retinol acyl transferase (LRAT), the enzyme that catalyzes the vitamin A to all trans retinol step of the chromophore regeneration process. Both mRPE65 and sRPE65 also serve as regulatory proteins, with the ratio and concentrations of these molecules playing a role in the inhibition of 11-cis retinal synthesis. Mutations in this gene have been associated with Leber congenital amaurosis type 2 (LCA2) and retinitis pigmentosa.
• Uniprot ID: Q16518
• Protein Accession #: NP_000320
• Protein Size (# AA): 533
• Molecular Weight: 58kDa
• Protein Interactions: UBC; PSMD13; SLC27A1; RBP4;