RNF43 Antibody - middle region (ARP43227_P050)

Catalog No: ARP43227_P050

25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 1 ug/mL of the antibody was used in this experiment.

Surface Plasmon Resonance Kinetic Characterization of Polyclonal Antibody Affinity. Purified polyclonal antibodies were immobilized on a Protein A/G coated Carterra LSA sensor chip (PAGH200M) at concentrations of 5, and 50 ug/mL in duplicate. Antibodies on the surface were exposed to interaction with peptides sequentially via microfluidic controlled flow at 333nM peptide concentration for kinetic characterization of the binders for affinity and specificity, followed by curve fitting using the Kinetics software. Kd determinations for both concentrations were averaged and results and standard deviation are shown.

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Horse, Rabbit
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human RNF43
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 86%; Dog: 93%; Horse: 93%; Human: 100%; Mouse: 100%; Rabbit: 93%; Rat: 100%
• Peptide Sequence: Synthetic peptide located within the following region: DFDPLVYCSPKGDPQRVDMQPSVTSRPRSLDSVVPTGETQVSSHVHYHRH
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-RNF43 (ARP43227_P050) antibody is Catalog # AAP43227 (Previous Catalog # AAPP25195)
• Sample Type Confirmation:

  RNF43 is supported by BioGPS gene expression data to be expressed in MCF7

• Enhanced Validation:

  Relative Expression (Western Blot)

• Reference: Sugiura,T., (2008) Exp. Cell Res. 314 (7), 1519-1528

Target Info

• Gene Symbol: RNF43
• Gene Full Name: Ring finger protein 43
• Alias Symbols: URCC, SSPCS, RNF124
• NCBI Gene Id: 54894
• Protein Name: E3 ubiquitin-protein ligase RNF43
• Description of Target: RNF43 is a HAP95 (AKAP8L) binding ubiquitin ligase that promotes cell growth and is upregulated in colon cancer.
• Uniprot ID: Q68DV7
• Protein Accession #: NP_060233
• Nucleotide Accession #: NM_017763
• Protein Size (# AA): 783
• Molecular Weight: 86 kDa
• Protein Interactions: RSPO1; SFPQ; NONO; HECW1; TP53; UBE2D4; KDM5B; UBE2E3; UBE2N; UBE2E1; UBE2D3; UBE2D2; UBE2D1; AKAP8L; UBC;