SAVE NOW with 10% off all Recombinant Antibodies Shop Now

Catalog No: ARP46340_P050
Price: $0.00
SKU
ARP46340_P050
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.
Datasheets/ManualsPrintable datasheet for anti-RMI1 (ARP46340_P050) antibody
Product Info
Tested Species ReactivityHuman
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human RMI1
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 93%; Dog: 100%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 93%; Rat: 93%
Peptide SequenceSynthetic peptide located within the following region: DGILEIPKGELNGFYALQINSLVDVSQPAYSQIQKLRGKNTTNDLVTAEA
Concentration0.5 mg/ml
Blocking PeptideFor anti-RMI1 (ARP46340_P050) antibody is Catalog # AAP46340 (Previous Catalog # AAPP27126)
ReferenceBroberg,K., (2007) Cancer Lett. 258 (1), 38-44
Gene SymbolRMI1
Gene Full NameRMI1, RecQ mediated genome instability 1, homolog (S. cerevisiae)
Alias SymbolsBLAP75, FAAP75, C9orf76
NCBI Gene Id80010
Protein NameRecQ-mediated genome instability protein 1
Description of TargetRMI1 is an essential component of the RMI complex, a complex that plays an important role in the processing of homologous recombination intermediates to limit DNA crossover formation in cells. RMI1 promotes TOP3A binding to double Holliday junctions (DHJ) and hence stimulates TOP3A-mediated dissolution. RMI1 is required for BLM phosphorylation during mitosis. Within the BLM complex, RMI1 is required for BLM and TOP3A stability.RMI1 is a component of protein complexes that limit DNA crossover formation via the dissolution of double Holliday junctions (Raynard et al., 2006 [PubMed 16595695]).[supplied by OMIM]. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-136 BP327553.1 1-136 137-885 DN997105.1 9-757 886-2740 AL732446.4 14777-16631 2741-3508 BC039999.2 2566-3333
Uniprot IDQ9H9A7
Protein Accession #NP_079221
Nucleotide Accession #NM_024945
Protein Size (# AA)625
Molecular Weight70 kDa
Protein InteractionsAPITD1; STRA13; UBC; RPA3; RPA2; RPA1; TOPBP1; BLM; NR1H2; UBE3A; HSPA13; PFDN1; Ercc6l; Top3a; FANCM; RMI2; FANCF; RMI1; FANCA;
  1. What is the species homology for "RMI1 Antibody - N-terminal region (ARP46340_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit".

  2. How long will it take to receive "RMI1 Antibody - N-terminal region (ARP46340_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "RMI1 Antibody - N-terminal region (ARP46340_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "RMI1 Antibody - N-terminal region (ARP46340_P050)"?

    This target may also be called "BLAP75, FAAP75, C9orf76" in publications.

  5. What is the shipping cost for "RMI1 Antibody - N-terminal region (ARP46340_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "RMI1 Antibody - N-terminal region (ARP46340_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "RMI1 Antibody - N-terminal region (ARP46340_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "70 kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "RMI1 Antibody - N-terminal region (ARP46340_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "RMI1"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "RMI1"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "RMI1"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "RMI1"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "RMI1"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "RMI1"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:RMI1 Antibody - N-terminal region (ARP46340_P050)
Your Rating