- Description of Target:
- The WNT gene family consists of structurally related genes which encode secreted signaling proteins. These proteins have been implicated in oncogenesis and in several developmental processes, including regulation of cell fate and patterning during embryogenesis. WNT5B gene is a member of the WNT gene family. WNT5B shows 94% and 80% amino acid identity to the mouse Wnt5b protein and the human WNT5A protein. The WNT gene family consists of structurally related genes which encode secreted signaling proteins. These proteins have been implicated in oncogenesis and in several developmental processes, including regulation of cell fate and patterning during embryogenesis. This gene is a member of the WNT gene family. It encodes a protein which shows 94% and 80% amino acid identity to the mouse Wnt5b protein and the human WNT5A protein, respectively. Alternative splicing of this gene generates 2 transcript variants.
- Gene Symbol:
- WNT5B
- Official Gene Full Name:
- Wingless-type MMTV integration site family, member 5B
- Tissue Tool:
- Find tissues and cell lines supported to express WNT5B.
- Protein Accession# :
- NP_116031
- Nucleotide Accession#:
- NM_032642
- Swissprot Id:
- Q9H1J7
- Host:
- Rabbit
- Clonality:
- Polyclonal
- Protein Size (# AA):
- 359
- Molecular Weight:
- 39kDa
- Application:
- WB
- Partner Proteins:
- C1QTNF5
- Immunogen:
- The immunogen for anti-WNT5B antibody: synthetic peptide directed towards the C terminal of human WNT5B
- Product Format:
- Lyophilized powder
- Purification:
- Protein A purified
- Complete computational species homology data:
- WNT5B antibody - C-terminal region (ARP41280_T100)
- Predicted Homology Based on Immunogen Sequence:
- Human: 100%; Chicken: 92%; Dog: 92%; Pig: 92%; Rabbit: 92%; African clawed frog: 85%; Bovine: 85%; Guinea pig: 85%; Mouse: 85%; Rat: 85%
- Datasheets / Downloads:
- Printable datasheet for
anti-WNT5B antibody
- ARP41280_T100 - Peptide Sequence:
- Synthetic peptide located within the following region: GRLCNKTSEGMDGCELMCCGRGYNQFKSVQVERCHCKFHWCCFVRCKKCT
- Blocking Peptide:
- For anti-WNT5B antibody is Catalog # AAP41280 (Previous Catalog # AAPP22635)
- Key Reference:
- Mangioni,S., (2005) J. Clin. Endocrinol. Metab. 90 (9), 5349-5355
- Reconstitution and Storage:
- Add 100 μl of distilled water. Final anti-WNT5B antibody concentration is 1 mg/ml in PBS buffer. For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.
Product Protocols: WNT5B antibody tested with Human Hepg2 Cells (ARP41280_T100)
Aviva Systems Biology is the original manufacturer of this WNT5B antibody (ARP41280_T100)
Click here to view the WNT5B antibody Western Blot Protocol
Product Datasheet Link: WNT5B antibody (ARP41280_T100)
WB Suggested Anti-WNT5B Antibody Titration: 1.25ug/ml
Positive Control: HepG2
Western Blot image: 
Description of Target: The WNT gene family consists of structurally related genes which encode secreted signaling proteins. These proteins have been implicated in oncogenesis and in several developmental processes, including regulation of cell fate and patterning during embryogenesis. WNT5B gene is a member of the WNT gene family. WNT5B shows 94% and 80% amino acid identity to the mouse Wnt5b protein and the human WNT5A protein. The WNT gene family consists of structurally related genes which encode secreted signaling proteins. These proteins have been implicated in oncogenesis and in several developmental processes, including regulation of cell fate and patterning during embryogenesis. This gene is a member of the WNT gene family. It encodes a protein which shows 94% and 80% amino acid identity to the mouse Wnt5b protein and the human WNT5A protein, respectively. Alternative splicing of this gene generates 2 transcript variants.
Questions pertaining to this data can be directed to techsupport@avivasysbio.com
Aviva Systems Biology’s WNT5B antibody (ARP41280_T100) has been tested using other cell lysates and tissues. To obtain more data about this antibody please email us at info@avivasysbio.com.
To order by phone call us at (888) 880-0001, fax us at (858) 552-6975 or send an email to info@avivasysbio.com. Aviva manufactures this antibody so we can offer the best price. Please contact us to request pricing information.
All of Aviva’s products are guaranteed for the applications and experimental sample types mentioned in the datasheet below. Are you curious if this product will work for you? Please contact us at techsupport@avivasysbio.com
- Protocol:
- Tips Information:
See our General FAQ page.
TO ORDER：
Tel:(888) 880-0001
Fax:(858) 552-6975
