WNT2 antibody - middle region (ARP32124_P050)

Catalog#: ARP32124_P050

• Size: 50ug

Human THP-1

• Description of Target: WNT2 is the ligand for members of the frizzled family of seven transmembrane receptors. WNT2 is a probable developmental protein. WNT2 may be a signaling molecule which affects the development of discrete regions of tissues. WNT2 is likely to signal over only few cell diameters.The WNT gene family consists of structurally related genes which encode secreted signaling proteins. These proteins have been implicated in oncogenesis and in several developmental processes, including regulation of cell fate and patterning during embryogenesis. This gene is a member of the WNT gene family, and is expressed in the thalamus. It encodes a protein which shows 96% amino acid identity to the mouse Wnt2 protein. Based on the map location of this gene in the 7q31 region, and the phenotype of the diminished social interaction in the knockout mouse, this gene is suggested as a strong candidate gene for autism, a prototypical pervasive development disorder. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
• Gene Symbol: WNT2
• Official Gene Full Name: Wingless-type MMTV integration site family member 2
• Alias Symbols: INT1L1; IRP
• Protein Accession#: NP_003382
• Nucleotide Accession#: NM_003391
• Swissprot Id: P09544
• Host: Rabbit
• Clonality: Polyclonal
• Protein Size (# AA): 360
• Molecular Weight: 38kDa
• Application: WB
• Partner Proteins: FZD6, PORCN, SFRP1, SFRP2, SFRP1, SFRP2
• Immunogen: The immunogen for anti-WNT2 antibody: synthetic peptide directed towards the middle region of human WNT2
• Product Format: Lyophilized powder
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Bovine: 100%; Dog: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%; Sheep: 100%; Chicken: 93%; Zebrafish: 86%
• Peptide Sequence: Synthetic peptide located within the following region: GSAKDSKGIFDWGGCSDNIDYGIKFARAFVDAKERKGKDARALMNLHNNR
• Blocking Peptide: For anti-WNT2 antibody is Catalog # AAP32124 (Previous Catalog # AAPP23847)
• Key Reference: Han,J.C., (2007) APMIS 115 (12), 1331-1343
• Reconstitution and Storage: Add 50 μl of distilled water. Final anti-WNT2 antibody concentration is 1 mg/ml in PBS buffer. For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Product Protocols: WNT2 antibody tested with Human Thp-1 Cells (ARP32124_P050)

Aviva Systems Biology is the original manufacturer of this WNT2 antibody (ARP32124_P050)

Click here to view the WNT2 antibody Western Blot Protocol

Product Datasheet Link: WNT2 antibody (ARP32124_P050)

WB Suggested Anti-WNT2 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: THP-1

Western Blot image:


Description of Target: WNT2 is the ligand for members of the frizzled family of seven transmembrane receptors. WNT2 is a probable developmental protein. WNT2 may be a signaling molecule which affects the development of discrete regions of tissues. WNT2 is likely to signal over only few cell diameters.The WNT gene family consists of structurally related genes which encode secreted signaling proteins. These proteins have been implicated in oncogenesis and in several developmental processes, including regulation of cell fate and patterning during embryogenesis. This gene is a member of the WNT gene family, and is expressed in the thalamus. It encodes a protein which shows 96% amino acid identity to the mouse Wnt2 protein. Based on the map location of this gene in the 7q31 region, and the phenotype of the diminished social interaction in the knockout mouse, this gene is suggested as a strong candidate gene for autism, a prototypical pervasive development disorder. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Questions pertaining to this data can be directed to techsupport@avivasysbio.com

Aviva Systems Biology’s WNT2 antibody (ARP32124_P050) has been tested using other cell lysates and tissues. To obtain more data about this antibody please email us at info@avivasysbio.com.

To order by phone call us at (888) 880-0001, fax us at (858) 552-6975 or send an email to info@avivasysbio.com. Aviva manufactures this antibody so we can offer the best price. Please contact us to request pricing information.

All of Aviva’s products are guaranteed for the applications and experimental sample types mentioned in the datasheet below. Are you curious if this product will work for you? Please contact us at techsupport@avivasysbio.com