- Description of Target:
- Members of the 'frizzled' gene family encode 7-transmembrane domain proteins that are receptors for Wnt signaling proteins. The expression of the FZD2 gene appears to be developmentally regulated, with high levels of expression in fetal kidney and lung an
- Gene Symbol:
- FZD2
- Official Gene Full Name:
- Frizzled family receptor 2
- Alias Symbols:
- Fz2; fz-2; fzE2; hFz2
- Tissue Tool:
- Find tissues and cell lines supported to express FZD2.
- Protein Accession# :
- NP_001457
- Nucleotide Accession#:
- NM_001466
- Swissprot Id:
- Q14332
- Host:
- Rabbit
- Clonality:
- Polyclonal
- Protein Size (# AA):
- 565
- Molecular Weight:
- 63kDa
- Application:
- WB
- Immunogen:
- The immunogen for anti-FZD2 antibody: synthetic peptide directed towards the N terminal of human FZD2
- Product Format:
- Lyophilized powder
- Purification:
- Affinity Purified
- Complete computational species homology data:
- FZD2 antibody - N-terminal region (ARP41236_P050)
- Predicted Homology Based on Immunogen Sequence:
- Bovine: 100%; Dog: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rat: 100%
- Datasheets / Downloads:
- Printable datasheet for
anti-FZD2 antibody
- ARP41236_P050 - Peptide Sequence:
- Synthetic peptide located within the following region: MRPRSALPRLLLPLLLLPAAGPAQFHGEKGISIPDHGFCQPISIPLCTDI
- Blocking Peptide:
- For anti-FZD2 antibody is Catalog # AAP41236 (Previous Catalog # AAPS01403)
- Key Reference:
- Li,C., (er) BMC Mol. Biol. 9, 11 (2008)
- Reconstitution and Storage:
- Add 50 μl of distilled water. Final anti-FZD2 antibody concentration is 1 mg/ml in PBS buffer. For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.
Product Protocols: FZD2 antibody tested with Human Fetal Spleen Tissue (ARP41236_P050)
Aviva Systems Biology is the original manufacturer of this FZD2 antibody (ARP41236_P050)
Click here to view the FZD2 antibody Western Blot Protocol
Product Datasheet Link: FZD2 antibody (ARP41236_P050)
WB Suggested Anti-FZD2 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: Fetal Spleen
Western Blot image: 
Description of Target: Members of the 'frizzled' gene family encode 7-transmembrane domain proteins that are receptors for Wnt signaling proteins. The expression of the FZD2 gene appears to be developmentally regulated, with high levels of expression in fetal kidney and lung an
Questions pertaining to this data can be directed to techsupport@avivasysbio.com
Aviva Systems Biology’s FZD2 antibody (ARP41236_P050) has been tested using other cell lysates and tissues. To obtain more data about this antibody please email us at info@avivasysbio.com.
To order by phone call us at (888) 880-0001, fax us at (858) 552-6975 or send an email to info@avivasysbio.com. Aviva manufactures this antibody so we can offer the best price. Please contact us to request pricing information.
All of Aviva’s products are guaranteed for the applications and experimental sample types mentioned in the datasheet below. Are you curious if this product will work for you? Please contact us at techsupport@avivasysbio.com
- Protocol:
- Tips Information:
See our General FAQ page.
TO ORDER：
Tel:(888) 880-0001
Fax:(858) 552-6975
