XAGE1D Antibody - C-terminal region (ARP60730_P050)

Catalog No: ARP60730_P050

WB Suggested Anti-XAGE1D Antibody
Titration: 1.0 ug/ml
Positive Control: Fetal kidney

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human, Dog, Pig
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Dog: 83%; Human: 100%; Pig: 91%
• Peptide Sequence: Synthetic peptide located within the following region: QCATWKVICKSCISQTPGINLDLGSGVKVKIIPKEEHCKMPEAGEEQPQV
• Concentration: 0.5 mg/ml
• Blocking Peptide: Catalog # AAP60730

Target Info

• Gene Symbol: XAGE1D
• Gene Full Name: X antigen family, member 1D
• Alias Symbols: CTP9, CT12.1, CT12.1D
• NCBI Gene Id: 9503
• Description of Target: This gene is a member of the XAGE subfamily, which belongs to the GAGE family. The GAGE genes are expressed in a variety of tumors and in some fetal and reproductive tissues. This gene is strongly expressed in Ewing's sarcoma, alveolar rhabdomyosarcoma and normal testis. The protein encoded by this gene contains a nuclear localization signal and shares a sequence similarity with other GAGE/PAGE proteins. Because of the expression pattern and the sequence similarity, this protein also belongs to a family of CT (cancer-testis) antigens.
• Uniprot ID: Q9HD64
• Protein Accession #: NP_597674
• Nucleotide Accession #: NM_133431
• Protein Size (# AA): 160
• Molecular Weight: 18kDa