- Description of Target:
- VGF is specifically expressed in a subpopulation of neuroendocrine cells, and is upregulated by nerve growth factor. It also shares similarities with the secretogranin/chromogranin family, however, its exact function is not known.This gene is specifically expressed in a subpopulation of neuroendocrine cells, and is upregulated by nerve growth factor. The structural organization of this gene is similar to that of the rat gene, and both the translated and the untranslated regions show a high degree of sequence similarity to the rat gene. The encoded secretory protein also shares similarities with the secretogranin/chromogranin family, however, its exact function is not known.
- Gene Symbol:
- VGF
- Official Gene Full Name:
- VGF nerve growth factor inducible
- Alias Symbols:
- -
- Tissue Tool:
- Find tissues and cell lines supported to express VGF.
- Protein Accession# :
- NP_003369
- Nucleotide Accession#:
- NM_003378
- Swissprot Id:
- O15240
- Host:
- Rabbit
- Clonality:
- Polyclonal
- Protein Size (# AA):
- 615
- Molecular Weight:
- 65kDa
- Application:
- WB
- Immunogen:
- The immunogen for anti-VGF antibody: synthetic peptide directed towards the middle region of human VGF
- Product Format:
- Lyophilized powder
- Purification:
- Affinity Purified
- Complete computational species homology data:
- VGF antibody - middle region (ARP42127_P050)
- Predicted Homology Based on Immunogen Sequence:
- Dog: 100%; Guinea pig: 100%; Human: 100%; Mouse: 100%; Rat: 100%; Bovine: 92%
- Datasheets / Downloads:
- Printable datasheet for
anti-VGF antibody
- ARP42127_P050 - Peptide Sequence:
- Synthetic peptide located within the following region: ARQNALLFAEEEDGEAGAEDKRSQEETPGHRRKEAEGTEEGGEEEDDEEM
- Blocking Peptide:
- For anti-VGF antibody is Catalog # AAP42127 (Previous Catalog # AAPS11612)
- Key Reference:
- Wedenoja,J., (er) Mol. Psychiatry (2007) In press
- Reconstitution and Storage:
- Add 50 μl of distilled water. Final anti-VGF antibody concentration is 1 mg/ml in PBS buffer. For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.
Product Protocols: VGF antibody tested with Human Transfected 293T Cells (ARP42127_P050)
Aviva Systems Biology is the original manufacturer of this VGF antibody (ARP42127_P050)
Click here to view the VGF antibody Western Blot Protocol
Product Datasheet Link: VGF antibody (ARP42127_P050)
WB Suggested Anti-VGF Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: Transfected 293T
Western Blot image: 
Description of Target: VGF is specifically expressed in a subpopulation of neuroendocrine cells, and is upregulated by nerve growth factor. It also shares similarities with the secretogranin/chromogranin family, however, its exact function is not known.This gene is specifically expressed in a subpopulation of neuroendocrine cells, and is upregulated by nerve growth factor. The structural organization of this gene is similar to that of the rat gene, and both the translated and the untranslated regions show a high degree of sequence similarity to the rat gene. The encoded secretory protein also shares similarities with the secretogranin/chromogranin family, however, its exact function is not known.
Questions pertaining to this data can be directed to techsupport@avivasysbio.com
Aviva Systems Biology’s VGF antibody (ARP42127_P050) has been tested using other cell lysates and tissues. To obtain more data about this antibody please email us at info@avivasysbio.com.
To order by phone call us at (888) 880-0001, fax us at (858) 552-6975 or send an email to info@avivasysbio.com. Aviva manufactures this antibody so we can offer the best price. Please contact us to request pricing information.
All of Aviva’s products are guaranteed for the applications and experimental sample types mentioned in the datasheet below. Are you curious if this product will work for you? Please contact us at techsupport@avivasysbio.com
- Protocol:
- Tips Information:
See our General FAQ page.
TO ORDER：
Tel:(888) 880-0001
Fax:(858) 552-6975
