- Toll Free: 888-880-0001
- Phone: 858-552-6979
- Email: info@avivasysbio.com
- $55: Antibody & Protein in US
- $55 + $25/Kit in US
- Contact us for international orders.
| Datasheets/Manuals | Printable datasheet for anti-UGT2B15 (ARP41906_P050) antibody |
|---|
| Tested Species Reactivity | Human |
|---|---|
| Predicted Species Reactivity | Human |
| Product Format | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Clonality | Polyclonal |
| Host | Rabbit |
| Application | WB |
| Reconstitution and Storage | For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human UGT2B15 |
| Purification | Affinity Purified |
| Predicted Homology Based on Immunogen Sequence | Human: 100% |
| Peptide Sequence | Synthetic peptide located within the following region: IKLEVYPTSLTKNYLEDSLLKILDRWIYGVSKNTFWSYFSQLQELCWEYY |
| Concentration | 0.5 mg/ml |
| Blocking Peptide | For anti-UGT2B15 (ARP41906_P050) antibody is Catalog # AAP41906 (Previous Catalog # AAPP24443) |
| Reference | Bao,B.Y., (2008) Prostate 68 (8), 839-848 |
| Gene Symbol | UGT2B15 |
|---|---|
| Gene Full Name | UDP glucuronosyltransferase 2 family, polypeptide B15 |
| Alias Symbols | HLUG4, UGT2B8, UDPGTH3, UDPGT 2B8, UDPGT2B15 |
| NCBI Gene Id | 7366 |
| Protein Name | UDP-glucuronosyltransferase 2B15 |
| Description of Target | The UGTs are of major importance in the conjugation and subsequent elimination of potentially toxic xenobiotics and endogenous compounds. UGT2B8 demonstrates reactivity with estriol. The UGTs are of major importance in the conjugation and subsequent elimination of potentially toxic xenobiotics and endogenous compounds. UGT2B8 demonstrates reactivity with estriol. See UGT2B4 (MIM 600067).[supplied by OMIM]. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-1605 AF180322.1 1-1605 1606-1700 U06641.1 1547-1641 1701-1798 U08854.1 1684-1781 1799-1801 U06641.1 1779-1781 1802-1837 U06641.1 1783-1818 1838-1909 U08854.1 1822-1893 1910-2106 AF180322.1 1911-2107 2107-2144 U06641.1 2086-2123 |
| Uniprot ID | P54855 |
| Protein Accession # | NP_001067 |
| Nucleotide Accession # | NM_001076 |
| Protein Size (# AA) | 530 |
| Molecular Weight | 61kDa |
- Protocol:
- Reconstitution & Storage Instructions
- Western Blotting/Immunoblotting (WB/IB) Protocol
- Immunohistochemistry (IHC) Protocol
- Immunocytochemistry (ICC) Protocol
- Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol
- Blocking Peptide Competition Protocol (BPCP)
- Immunoprecipitation (IP) Protocol
- Antibody Array (AA) Protocol
- Tips Information:
-
See our General FAQ page.
-
What is the species homology for "UGT2B15 Antibody - N-terminal region (ARP41906_P050)"?
The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human".
-
How long will it take to receive "UGT2B15 Antibody - N-terminal region (ARP41906_P050)"?
This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".
-
What buffer format is "UGT2B15 Antibody - N-terminal region (ARP41906_P050)" provided in?
This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
Additional format options may be available. For more information please contact info@avivasysbio.com. -
What are other names for "UGT2B15 Antibody - N-terminal region (ARP41906_P050)"?
This target may also be called "HLUG4, UGT2B8, UDPGTH3, UDPGT 2B8, UDPGT2B15" in publications.
-
What is the shipping cost for "UGT2B15 Antibody - N-terminal region (ARP41906_P050)"?
The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.
-
What is the guarantee for "UGT2B15 Antibody - N-terminal region (ARP41906_P050)"?
All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.
-
Can I get bulk pricing for "UGT2B15 Antibody - N-terminal region (ARP41906_P050)"?
You can get bulk pricing for this item by going here.
-
What is the molecular weight of the protein?
The molecular weight reported by Uniprot for this item is "61kDa".
Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics. -
What protocols are available for "UGT2B15 Antibody - N-terminal region (ARP41906_P050)"?
We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.
-
What are positive controls for "UGT2B15"?
We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.
-
What are negative controls for "UGT2B15"?
We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.
-
What other proteins interact with "UGT2B15"?
This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.
-
What biological processes are associated with "UGT2B15"?
This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.
-
What cellular components are associated with "UGT2B15"?
This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.
-
What protein functions are associated with "UGT2B15"?
This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.
