SAVE NOW with 10% off all Recombinant Antibodies Shop Now

Catalog No: ARP42247_T100
Price: $0.00
SKU
ARP42247_T100
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.
Datasheets/ManualsPrintable datasheet for anti-SLC1A5 (ARP42247_T100) antibody
Product Info
Tested Species ReactivityHuman, Cow
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit, Sheep, Zebrafish
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationIHC, WB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human SLC1A5
PurificationProtein A purified
Predicted Homology Based on Immunogen SequenceCow: 100%; Dog: 100%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 93%; Rat: 100%; Sheep: 100%; Zebrafish: 86%
Peptide SequenceSynthetic peptide located within the following region: FGVALRKLGPEGELLIRFFNSFNEATMVLVSWIMWYAPVGIMFLVAGKIV
Concentration1.0 mg/ml
Blocking PeptideFor anti-SLC1A5 (ARP42247_T100) antibody is Catalog # AAP42247 (Previous Catalog # AAPP24670)
Sample Type Confirmation

SLC1A5 is supported by BioGPS gene expression data to be expressed in Jurkat

Enhanced Validation
Relative Expression (Western Blot) Avivasheild
SPR Affinity Characterization
YCHAROS  
ReferenceBungard,C.I. Arch. Biochem. Biophys. 443 (1-2), 53-59 (2005)
Publications

Metabolic maintenance of cell asymmetry following division in activated T lymphocytes. Nature. 532, 389-93 (2016). 27064903

Protein Restriction with Amino Acid-Balanced Diets Shrinks Circulating Pool Size of Amino Acid by Decreasing Expression of Specific Transporters in the Small Intestine. PLoS ONE. 11, e0162475 (2016). 27611307

Zhu, Y. et al. L-Glutamine deprivation induces autophagy and alters the mTOR and MAPK signaling pathways in porcine intestinal epithelial cells. Amino Acids (2014). doi:10.1007/s00726-014-1785-0 24997162

Description
Gene SymbolSLC1A5
Gene Full NameSolute carrier family 1 (neutral amino acid transporter), member 5
Alias SymbolsR16, AAAT, ATBO, M7V1, RDRC, ASCT2, M7VS1
NCBI Gene Id6510
Protein NameNeutral amino acid transporter EMBL AAD09814.1
Description of TargetSLC1A5 has a broad substrate specificity, a preference for zwitterionic amino acids, and a sodium-dependence. It accepts as substrates all neutral amino acids, including glutamine, asparagine, and branched-chain and aromatic amino acids, and excludes methylated amino acids, anionic amino acids, and cationic amino acids. It acts as a cell surface receptor for feline endogenous virus RD114, baboon M7 endogenous virus and type D simian retroviruses.
Uniprot IDQ71UA6
Protein Accession #NP_005619
Nucleotide Accession #NM_005628
Protein Size (# AA)541
Molecular Weight57 kDa
Protein InteractionsUBC; FUS; LGR4; ADRB2; ALB; PAXIP1; ECT2; MCU; MRPS35; CYB5R3; CAND1; CUL3; USP50; USP19; TBC1D17; ERVW-1; NEK6; MPDU1; LGALS9;
  1. What is the species homology for "SLC1A5 Antibody - middle region (ARP42247_T100) "?

    The tested species reactivity for this item is "Human, Cow". This antibody is predicted to have homology to "Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit, Sheep, Zebrafish".

  2. How long will it take to receive "SLC1A5 Antibody - middle region (ARP42247_T100) "?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "SLC1A5 Antibody - middle region (ARP42247_T100) " provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "SLC1A5 Antibody - middle region (ARP42247_T100) "?

    This target may also be called "R16, AAAT, ATBO, M7V1, RDRC, ASCT2, M7VS1" in publications.

  5. What is the shipping cost for "SLC1A5 Antibody - middle region (ARP42247_T100) "?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "SLC1A5 Antibody - middle region (ARP42247_T100) "?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "SLC1A5 Antibody - middle region (ARP42247_T100) "?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "57 kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "SLC1A5 Antibody - middle region (ARP42247_T100) "?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "SLC1A5"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "SLC1A5"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "SLC1A5"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "SLC1A5"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "SLC1A5"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "SLC1A5"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:SLC1A5 Antibody - middle region (ARP42247_T100)
Your Rating
We found other products you might like!