SLC13A3 Antibody - middle region (ARP41439_T100)

Catalog No: ARP41439_T100

WB Suggested Anti-SLC13A3 Antibody Titration: 2.5ug/ml
Positive Control: Jurkat cell lysate

Host: Rabbit
Target: SLC13A3
Positive control (+): HepG2 (HG)
Negative control (-): 293T (2T)
Antibody concentration: 2.5ug/ml

Rabbit Anti-SLC13A3 Antibody
Catalog Number: ARP41439
Paraffin Embedded Tissue: Human Kidney
Cellular Data: Epithelial cells of renal tubule
Antibody Concentration: 4.0-8.0 ug/ml
Magnification: 400X

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Horse, Pig, Rabbit, Zebrafish
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: IHC, WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human SLC13A3
• Purification: Protein A purified
• Predicted Homology Based on Immunogen Sequence: Cow: 86%; Dog: 93%; Horse: 93%; Human: 100%; Mouse: 92%; Pig: 85%; Rabbit: 93%; Rat: 92%; Zebrafish: 77%
• Peptide Sequence: Synthetic peptide located within the following region: GLSFRGWRKNKSEIRTNAEDRARAVIREEYQNLGPIKFAEQAVFILFCMF
• Concentration: 1.0 mg/ml
• Blocking Peptide: For anti-SLC13A3 (ARP41439_T100) antibody is Catalog # AAP41439 (Previous Catalog # AAPP24176)
• Reference: Bai,X., (2006) J. Cell. Physiol. 206 (3), 821-830

Target Info

• Gene Symbol: SLC13A3
• Gene Full Name: Solute carrier family 13 (sodium-dependent dicarboxylate transporter), member 3
• Alias Symbols: NADC3, SDCT2, ARLIAK
• NCBI Gene Id: 64849
• Protein Name: Solute carrier family 13 member 3
• Description of Target: Mammalian sodium-dicarboxylate cotransporters transport succinate and other Krebs cycle intermediates. They fall into 2 categories based on their substrate affinity: low affinity and high affinity. Both the low- and high-affinity transporters play an important role in the handling of citrate by the kidneys. SLC13A3 represents the high-affinity form.Mammalian sodium-dicarboxylate cotransporters transport succinate and other Krebs cycle intermediates. They fall into 2 categories based on their substrate affinity: low affinity and high affinity. Both the low- and high-affinity transporters play an important role in the handling of citrate by the kidneys. The protein encoded by this gene represents the high-affinity form. Alternatively spliced transcript variants encoding different isoforms have been found for this gene, although the full-length nature of some of them have not been characterized yet.
• Uniprot ID: Q8WWT9
• Protein Accession #: NP_001011554
• Nucleotide Accession #: NM_001011554
• Protein Size (# AA): 555
• Molecular Weight: 61kDa