website statistics

Aviva Systems Biology

Account Login 

Now Offering Over 85,203 Antibodies & 34,301 Antigens!

Print Page
50ug
$289.00
In Stock

SLC12A1 antibody - N-terminal region (ARP41388_P050)

Publications:

Anti-NKCC2 ARP41388_P050 has recently been referenced in the following publications:

Kelsen, S. et al. Heme oxygenase attenuates angiotensin II-mediated superoxide production in cultured mouse thick ascending loop of Henle cells. Am. J. Physiol. Renal Physiol. 295, F1158–65 (2008). WB, Human 18701634

Stec, D. E. et al. Expression of heme oxygenase-1 in thick ascending loop of henle attenuates angiotensin II-dependent hypertension. J. Am. Soc. Nephrol. 23, 834–41 (2012). WB, Mouse 22323644

Description of Target:
The sodium-potassium-chloride cotransporter isoform 2 is kidney-specific and is found on the apical membrane of the thick ascending limb of Henle's loop and the macula densa. It accounts for most of the NaCl resorption with the stoichiometry of 1Na:1K:2Cl and is sensitive to such diuretics as furosemide and bumetanide. Some Bartter-like syndromes result from defects in this gene.
Gene Symbol:
SLC12A1
Official Gene Full Name:
Solute carrier family 12 (sodium/potassium/chloride transporters), member 1
NCBI Gene Id:
6557
Alias Symbols:
BSC1; MGC48843; NKCC2
Tissue Tool:
Find tissues and cell lines supported to express SLC12A1.
Protein Accession #:
AAH40138
Nucleotide Accession#:
NM_000338
Swissprot Id:
Q8IUN5
Host:
Rabbit
Clonality:
Polyclonal
Protein Name:
SLC12A1 protein EMBL AAH40138.1
Protein Size (# AA):
430
Molecular Weight:
47kDa
Application:
IHC, WB
Partner Proteins:
ACTA1, PAPPA, PKD2, PKD2L1, PRKCA, RCAN3, TNNC1, TNNI3, TNNI3K, TNNT1, TNNT2, LYST, PKD2, PKD2L1, TNNC1, TNNI3K, TNNT2
Immunogen:
The immunogen for anti-SLC12A1 antibody: synthetic peptide directed towards the N terminal of human SLC12A1
Product Format:
Lyophilized powder
Purification:
Affinity Purified
Complete computational species homology data:
SLC12A1 antibody - N-terminal region (ARP41388_P050)
Predicted Homology Based on Immunogen Sequence:
Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 93%
Species Reactivity:
Mouse, Rat, Human, Dog, Pig, Horse, Rabbit, Bovine, Guinea pig
Datasheets / Downloads:
Printable datasheet for
anti-SLC12A1 antibody
- ARP41388_P050
Peptide Sequence:
Synthetic peptide located within the following region: NEKKSRGFFNYQASIFAENFGPRFTKGEGFFSVFAIFFPAATGILAGANI
Blocking Peptide:
For anti-SLC12A1 antibody is Catalog # AAP41388 (Previous Catalog # AAPP24126)
Reconstitution and Storage:
Add 50 ul of distilled water. Final anti-SLC12A1 antibody concentration is 1 mg/ml in PBS buffer with 2% sucrose. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles.
 
X
Ask a Question