website statistics

Now Offering Over 102,157 Antibodies & 44,722 Antigens!

SLC12A1 antibody - N-terminal region (ARP41388_P050)

Scroll Horizontally to view all Images
Print Page
  • Let us Help: Ask a Question
100 ul
In Stock

Conjugation Options

ARP41388_P050-FITC Conjugated

ARP41388_P050-HRP Conjugated

ARP41388_P050-Biotin Conjugated

Gene Symbol:
NCBI Gene Id:
Official Gene Full Name:
Solute carrier family 12 (sodium/potassium/chloride transporters), member 1
Protein Name:
SLC12A1 protein EMBL AAH40138.1
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
BSC1, MGC48843, NKCC2
Replacement Item:
This antibody may replace item sc-133823 from Santa Cruz Biotechnology.
Description of Target:
The sodium-potassium-chloride cotransporter isoform 2 is kidney-specific and is found on the apical membrane of the thick ascending limb of Henle's loop and the macula densa. It accounts for most of the NaCl resorption with the stoichiometry of 1Na:1K:2Cl and is sensitive to such diuretics as furosemide and bumetanide. Some Bartter-like syndromes result from defects in this gene.
Protein Size (# AA):
Molecular Weight:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express SLC12A1.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express SLC12A1.
The immunogen is a synthetic peptide directed towards the N terminal region of human SLC12A1
Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%
Complete computational species homology data:
Anti-SLC12A1 (ARP41388_P050)
Peptide Sequence:
Synthetic peptide located within the following region: NEKKSRGFFNYQASIFAENFGPRFTKGEGFFSVFAIFFPAATGILAGANI
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
Blocking Peptide:
For anti-SLC12A1 (ARP41388_P050) antibody is Catalog # AAP41388 (Previous Catalog # AAPP24126)
Datasheets / Downloads:
Printable datasheet for anti-SLC12A1 (ARP41388_P050) antibody

Kelsen, S. et al. Heme oxygenase attenuates angiotensin II-mediated superoxide production in cultured mouse thick ascending loop of Henle cells. Am. J. Physiol. Renal Physiol. 295, F1158-65 (2008). WB, Mouse, Rat, Human, Dog, Pig, Horse, Rabbit, Bovine, Guinea pig 18701634

Stec, D. E. et al. Expression of heme oxygenase-1 in thick ascending loop of henle attenuates angiotensin II-dependent hypertension. J. Am. Soc. Nephrol. 23, 834-41 (2012). WB, Mouse, Rat, Human, Dog, Pig, Horse, Rabbit, Bovine, Guinea pig 22323644

Product Protocols: SLC12A1 antibody tested with Human Jurkat Cells (ARP41388_P050)

Aviva Systems Biology is the original manufacturer of this SLC12A1 antibody (ARP41388_P050)

Click here to view the SLC12A1 antibody Western Blot Protocol

Product Datasheet Link: SLC12A1 antibody (ARP41388_P050)

WB Suggested Anti-SLC12A1 Antibody Titration: 0.2-1 ug/ml
Positive Control: Jurkat

Western Blot image:

Description of Target: The sodium-potassium-chloride cotransporter isoform 2 is kidney-specific and is found on the apical membrane of the thick ascending limb of Henle's loop and the macula densa. It accounts for most of the NaCl resorption with the stoichiometry of 1Na:1K:2Cl and is sensitive to such diuretics as furosemide and bumetanide. Some Bartter-like syndromes result from defects in this gene.

Questions pertaining to this data can be directed to

Aviva Systems Biology’s SLC12A1 antibody (ARP41388_P050) has been tested using other cell lysates and tissues. To obtain more data about this antibody please email us at

To order by phone call us at (888) 880-0001, fax us at (858) 552-6975 or send an email to Aviva manufactures this antibody so we can offer the best price. Please contact us to request pricing information.

All of Aviva’s products are guaranteed for the applications and experimental sample types mentioned in the datasheet below. Are you curious if this product will work for you? Please contact us at

Product Protocols: SLC12A1 antibody tested by IHC with human kidney (ARP41388)

Aviva Systems Biology is the original manufacturer of this SLC12A1 antibody.

Click here to view the SLC12A1 antibody Immunohistochemistry (IHC) protocol

Product Datasheet Link: SLC12A1 antibody (ARP41388)

IHC Information:

Rabbit Anti-SLC12A1 Antibody
Catalog Number: ARP41388
Paraffin Embedded Tissue: Human Kidney
Cellular Data: Epithelial cells of renal tubule
Antibody Concentration: 4.0-8.0 ug/ml
Magnification: 400X

IHC Image:

Ask a Question

Tell us what you think about this item!

Write A Review
    Please, wait...