website statistics
Account Login 

Aviva Systems Biology office will be closed for Labor Day - Monday 9/1/2014.
Please go here for more info.

Now Offering Over 85,203 Antibodies & 34,301 Antigens!

Print Page
50ug
$289.00
In Stock

SLC12A1 antibody - N-terminal region (ARP41388_P050)

Description of Target:
The sodium-potassium-chloride cotransporter isoform 2 is kidney-specific and is found on the apical membrane of the thick ascending limb of Henle's loop and the macula densa. It accounts for most of the NaCl resorption with the stoichiometry of 1Na:1K:2Cl and is sensitive to such diuretics as furosemide and bumetanide. Some Bartter-like syndromes result from defects in this gene.
Gene Symbol:
SLC12A1
Official Gene Full Name:
Solute carrier family 12 (sodium/potassium/chloride transporters), member 1
NCBI Gene Id:
6557
Alias Symbols:
BSC1; MGC48843; NKCC2
Tissue Tool:
Find tissues and cell lines supported to express SLC12A1.
Protein Accession #:
AAH40138
Nucleotide Accession#:
NM_000338
Swissprot Id:
Q8IUN5
Host:
Rabbit
Clonality:
Polyclonal
Protein Name:
SLC12A1 protein EMBL AAH40138.1
Protein Size (# AA):
430
Molecular Weight:
47kDa
Application:
IHC, WB
Partner Proteins:
ACTA1, PAPPA, PKD2, PKD2L1, PRKCA, RCAN3, TNNC1, TNNI3, TNNI3K, TNNT1, TNNT2, LYST, PKD2, PKD2L1, TNNC1, TNNI3K, TNNT2
Immunogen:
The immunogen for anti-SLC12A1 antibody: synthetic peptide directed towards the N terminal of human SLC12A1
Product Format:
Lyophilized powder
Purification:
Affinity Purified
Complete computational species homology data:
SLC12A1 antibody - N-terminal region (ARP41388_P050)
Predicted Homology Based on Immunogen Sequence:
Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 93%
Species Reactivity:
Mouse, Rat, Human, Dog, Pig, Horse, Rabbit, Bovine, Guinea pig
Datasheets / Downloads:
Printable datasheet for
anti-SLC12A1 antibody
- ARP41388_P050
Peptide Sequence:
Synthetic peptide located within the following region: NEKKSRGFFNYQASIFAENFGPRFTKGEGFFSVFAIFFPAATGILAGANI
Blocking Peptide:
For anti-SLC12A1 antibody is Catalog # AAP41388 (Previous Catalog # AAPP24126)
Reconstitution and Storage:
Add 50 ul of distilled water. Final anti-SLC12A1 antibody concentration is 1 mg/ml in PBS buffer with 2% sucrose. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles.
Publications:

Anti-NKCC2 ARP41388_P050 has recently been referenced in the following publications:

Kelsen, S. et al. Heme oxygenase attenuates angiotensin II-mediated superoxide production in cultured mouse thick ascending loop of Henle cells. Am. J. Physiol. Renal Physiol. 295, F1158–65 (2008). WB, Human 18701634

Stec, D. E. et al. Expression of heme oxygenase-1 in thick ascending loop of henle attenuates angiotensin II-dependent hypertension. J. Am. Soc. Nephrol. 23, 834–41 (2012). WB, Mouse 22323644

Computational species homology for SLC12A1 antibody (ARP41388)

Product page for SLC12A1 antibody (ARP41388)

The information below lists the predicted species and target name associated to the peptide antigen. Please note, all available target reference numbers to the antigen sequence are presented, including unreviewed and protein isoforms.
To search for antibodies by species, please visit Aviva’s Species Reactivity Page. To search Aviva’s catalog of antibodies by sequence, please visit Aviva’s Antibody Blast Tool.

Predicted Species & Target Target Reference Predicted Homology
African elephant SLC12A1 antibody; Loxodonta africana SLC12A1 antibody G3TVK7 92%
African elephant SLC12A1 antibody; Loxodonta africana SLC12A1 antibody G3TAH4 92%
Black-banded sea krait SLC12A1 antibody; Laticauda semifasciata SLC12A1 antibody F8RYH1 84%
Bovine 532707 antibody; Bos taurus 532707 antibody F1MI82 85%
Bovine SLC12A1 antibody; Bos taurus SLC12A1 antibody Q9XSK4 100%
Bovine SLC12A1 antibody; Bos taurus SLC12A1 antibody F1MS75 85%
Chicken SLC12A1 antibody; Gallus gallus SLC12A1 antibody E1BTK6 92%
Common turkey SLC12A1 antibody; Meleagris gallopavo SLC12A1 antibody G1N4Z7 85%
Dog SLC12A1 antibody; Canis familiaris SLC12A1 antibody E2RRI1 100%
Duckbill platypus SLC12A8 antibody; Ornithorhynchus anatinus SLC12A8 antibody F6XXR1 100%
European domestic ferret SLC12A1 antibody; Mustela putorius furo SLC12A1 antibody C7F7M3 100%
European domestic ferret SLC12A1 antibody; Mustela putorius furo SLC12A1 antibody C7F7M2 100%
European domestic ferret SLC12A1 antibody; Mustela putorius furo SLC12A1 antibody C7F7M1 100%
Giant panda LOC100476129 antibody; Ailuropoda melanoleuca LOC100476129 antibody D2H739 100%
Gray short-tailed opossum SLC12A1 antibody; Monodelphis domestica SLC12A1 antibody F7CEB2 100%
Gray short-tailed opossum SLC12A1 antibody; Monodelphis domestica SLC12A1 antibody F6Z7L7 100%
Guinea pig SLC12A1 antibody; Cavia porcellus SLC12A1 antibody H0V4Q5 92%
Horse LOC100055787 antibody; Equus caballus LOC100055787 antibody F7DZ37 100%
Horse LOC100055787 antibody; Equus caballus LOC100055787 antibody F6W7M6 100%
Horse SLC12A1 antibody; Equus caballus SLC12A1 antibody F6WDU6 100%
Human S12A1 antibody; Homo sapiens S12A1 antibody Q13621 100%
Human S12A1 antibody; Homo sapiens S12A1 antibody Q13621-3 100%
Human SLC12A1 antibody; Homo sapiens SLC12A1 antibody Q8IUN5 100%
Human SLC12A1 antibody; Homo sapiens SLC12A1 antibody H0YNL0 100%
Human SLC12A1 antibody; Homo sapiens SLC12A1 antibody H0YLJ2 100%
Human SLC12A1 antibody; Homo sapiens SLC12A1 antibody E9PDW4 100%
Human SLC12A1 antibody; Homo sapiens SLC12A1 antibody E7ES04 100%
Human SLC12A1 antibody; Homo sapiens SLC12A1 antibody B4DPF4 100%
Japanese flounder fNKCC antibody; Paralichthys olivaceus fNKCC antibody G1UHB4 81%
Little brown bat SLC12A1 antibody; Myotis lucifugus SLC12A1 antibody G1P7W7 100%
Lowland gorilla SLC12A1 antibody; Gorilla gorilla gorilla SLC12A1 antibody G3RVD8 92%
Lowland gorilla SLC12A1 antibody; Gorilla gorilla gorilla SLC12A1 antibody G3QEP7 92%
Mouse S12A1 antibody; Mus musculus S12A1 antibody P55014 100%
Mouse S12A1 antibody; Mus musculus S12A1 antibody P55014-4 100%
Mouse S12A1 antibody; Mus musculus S12A1 antibody P55014-3 100%
Mouse S12A1 antibody; Mus musculus S12A1 antibody P55014-2 100%
Mouse Slc12a1 antibody; Mus musculus Slc12a1 antibody A2AQ52 100%
Mouse Slc12a1 antibody; Mus musculus Slc12a1 antibody A2AQ51 100%
Mouse Slc12a1 antibody; Mus musculus Slc12a1 antibody A2AQ50 100%
Nerodia clarkii clarkii SLC12A1 antibody F8RYH2 84%
Nerodia fasciata SLC12A1 antibody F8RYH3 84%
Northern white-cheeked gibbon SLC12A1 antibody; Nomascus leucogenys SLC12A1 antibody G1R224 100%
Northern white-cheeked gibbon SLC12A1 antibody; Nomascus leucogenys SLC12A1 antibody G1R219 100%
Northern white-cheeked gibbon SLC12A1 antibody; Nomascus leucogenys SLC12A1 antibody G1R214 100%
Northern white-cheeked gibbon SLC12A1 antibody; Nomascus leucogenys SLC12A1 antibody G1R211 100%
Pig SLC12A1 antibody; Sus scrofa SLC12A1 antibody F1SN65 100%
Rabbit S12A1 antibody; Oryctolagus cuniculus S12A1 antibody P55015 100%
Rabbit S12A1 antibody; Oryctolagus cuniculus S12A1 antibody P55015-3 100%
Rabbit S12A1 antibody; Oryctolagus cuniculus S12A1 antibody P55015-2 100%
Rat S12A1 antibody; Rattus norvegicus S12A1 antibody P55016 100%
Rat Slc12a1 antibody; Rattus norvegicus Slc12a1 antibody Q5PQV1 100%
Rat Slc12a1 antibody; Rattus norvegicus Slc12a1 antibody G8HI66 100%
Rat Slc12a1 antibody; Rattus norvegicus Slc12a1 antibody G8HI65 100%
Rat Slc12a1 antibody; Rattus norvegicus Slc12a1 antibody G3V6U1 100%
Rat Slc12a1 antibody; Rattus norvegicus Slc12a1 antibody D3ZPL4 100%
Rat Slc12a1 antibody; Rattus norvegicus Slc12a1 antibody A8JYG7 100%
Rhesus macaque SLC12A1 antibody; Macaca mulatta SLC12A1 antibody F7CQA3 100%
Rhesus macaque SLC12A1 antibody; Macaca mulatta SLC12A1 antibody F7CQ95 100%
Small-eared galago SLC12A1 antibody; Otolemur garnettii SLC12A1 antibody H0X3Q2 100%
Sumatran orangutan DKFZp469A2020 antibody; Pongo abelii DKFZp469A2020 antibody Q5R825 100%
Tasmanian devil SLC12A1 antibody; Sarcophilus harrisii SLC12A1 antibody G3WFU8 92%
Tasmanian devil SLC12A1 antibody; Sarcophilus harrisii SLC12A1 antibody G3WFU7 92%
White-tufted-ear marmoset SLC12A1 antibody; Callithrix jacchus SLC12A1 antibody F7EMX2 100%
White-tufted-ear marmoset SLC12A1 antibody; Callithrix jacchus SLC12A1 antibody F7EMP0 100%
White-tufted-ear marmoset SLC12A1 antibody; Callithrix jacchus SLC12A1 antibody F7EA59 100%
White-tufted-ear marmoset SLC12A1 antibody; Callithrix jacchus SLC12A1 antibody F7DVQ7 100%
Zebra finch SLC12A1 antibody; Taeniopygia guttata SLC12A1 antibody H0ZA09 92%

Product Protocols: SLC12A1 antibody tested with Human Jurkat Cells (ARP41388_P050)

Aviva Systems Biology is the original manufacturer of this SLC12A1 antibody (ARP41388_P050)

Click here to view the SLC12A1 antibody Western Blot Protocol

Product Datasheet Link: SLC12A1 antibody (ARP41388_P050)

WB Suggested Anti-SLC12A1 Antibody Titration: 0.2-1 ug/ml
Positive Control: Jurkat

Western Blot image:


Description of Target: The sodium-potassium-chloride cotransporter isoform 2 is kidney-specific and is found on the apical membrane of the thick ascending limb of Henle's loop and the macula densa. It accounts for most of the NaCl resorption with the stoichiometry of 1Na:1K:2Cl and is sensitive to such diuretics as furosemide and bumetanide. Some Bartter-like syndromes result from defects in this gene.

Questions pertaining to this data can be directed to techsupport@avivasysbio.com

Aviva Systems Biology’s SLC12A1 antibody (ARP41388_P050) has been tested using other cell lysates and tissues. To obtain more data about this antibody please email us at info@avivasysbio.com.

To order by phone call us at (888) 880-0001, fax us at (858) 552-6975 or send an email to info@avivasysbio.com. Aviva manufactures this antibody so we can offer the best price. Please contact us to request pricing information.

All of Aviva’s products are guaranteed for the applications and experimental sample types mentioned in the datasheet below. Are you curious if this product will work for you? Please contact us at techsupport@avivasysbio.com

Product Protocols: SLC12A1 antibody tested by IHC with human kidney (ARP41388)

Aviva Systems Biology is the original manufacturer of this SLC12A1 antibody.

Click here to view the SLC12A1 antibody Immunohistochemistry (IHC) protocol

Product Datasheet Link: SLC12A1 antibody (ARP41388)

IHC Information:

Rabbit Anti-SLC12A1 Antibody
Catalog Number: ARP41388
Paraffin Embedded Tissue: Human Kidney
Cellular Data: Epithelial cells of renal tubule
Antibody Concentration: 4.0-8.0 ug/ml
Magnification: 400X

IHC Image:

 
X
Ask a Question