website statistics
Account Login 

Aviva Systems Biology office will be closed for Memorial Day - 5/25/2015.
Please go here for more info.

Now Offering Over 85,203 Antibodies & 34,301 Antigens!

Print Page
100 ul
$289.00
In Stock

SLC12A1 antibody - N-terminal region (ARP41388_P050)

Description of Target:
The sodium-potassium-chloride cotransporter isoform 2 is kidney-specific and is found on the apical membrane of the thick ascending limb of Henle's loop and the macula densa. It accounts for most of the NaCl resorption with the stoichiometry of 1Na:1K:2Cl and is sensitive to such diuretics as furosemide and bumetanide. Some Bartter-like syndromes result from defects in this gene.
Gene Symbol:
SLC12A1
Official Gene Full Name:
Solute carrier family 12 (sodium/potassium/chloride transporters), member 1
NCBI Gene Id:
6557
Alias Symbols:
BSC1; MGC48843; NKCC2
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express SLC12A1.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express SLC12A1.
Swissprot Id:
Q8IUN5
Protein Accession #:
AAH40138
Nucleotide Accession #:
NM_000338
Host:
Rabbit
Clonality:
Polyclonal
Protein Name:
SLC12A1 protein EMBL AAH40138.1
Protein Size (# AA):
430
Molecular Weight:
47kDa
Application:
IHC, WB
Protein Interactions:
STK39; OXSR1;
Immunogen:
The immunogen for anti-SLC12A1 antibody: synthetic peptide directed towards the N terminal of human SLC12A1
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Purification:
Affinity Purified
Complete computational species homology data:
SLC12A1 antibody - N-terminal region (ARP41388_P050)
Predicted Homology Based on Immunogen Sequence:
Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 93%
Species Reactivity:
Mouse, Rat, Human, Dog, Pig, Horse, Rabbit, Bovine, Guinea pig
Datasheets / Downloads:
Printable datasheet for
anti-SLC12A1 antibody
- ARP41388_P050
Peptide Sequence:
Synthetic peptide located within the following region: NEKKSRGFFNYQASIFAENFGPRFTKGEGFFSVFAIFFPAATGILAGANI
Blocking Peptide:
For anti-SLC12A1 antibody is Catalog # AAP41388 (Previous Catalog # AAPP24126)
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Publications:

Kelsen, S. et al. Heme oxygenase attenuates angiotensin II-mediated superoxide production in cultured mouse thick ascending loop of Henle cells. Am. J. Physiol. Renal Physiol. 295, F1158-65 (2008). WB, Mouse, Rat, Human, Dog, Pig, Horse, Rabbit, Bovine, Guinea pig 18701634

Stec, D. E. et al. Expression of heme oxygenase-1 in thick ascending loop of henle attenuates angiotensin II-dependent hypertension. J. Am. Soc. Nephrol. 23, 834-41 (2012). WB, Mouse, Rat, Human, Dog, Pig, Horse, Rabbit, Bovine, Guinea pig 22323644

Product Protocols: SLC12A1 antibody tested with Human Jurkat Cells (ARP41388_P050)

Aviva Systems Biology is the original manufacturer of this SLC12A1 antibody (ARP41388_P050)

Click here to view the SLC12A1 antibody Western Blot Protocol

Product Datasheet Link: SLC12A1 antibody (ARP41388_P050)

WB Suggested Anti-SLC12A1 Antibody Titration: 0.2-1 ug/ml
Positive Control: Jurkat

Western Blot image:


Description of Target: The sodium-potassium-chloride cotransporter isoform 2 is kidney-specific and is found on the apical membrane of the thick ascending limb of Henle's loop and the macula densa. It accounts for most of the NaCl resorption with the stoichiometry of 1Na:1K:2Cl and is sensitive to such diuretics as furosemide and bumetanide. Some Bartter-like syndromes result from defects in this gene.

Questions pertaining to this data can be directed to techsupport@avivasysbio.com

Aviva Systems Biology’s SLC12A1 antibody (ARP41388_P050) has been tested using other cell lysates and tissues. To obtain more data about this antibody please email us at info@avivasysbio.com.

To order by phone call us at (888) 880-0001, fax us at (858) 552-6975 or send an email to info@avivasysbio.com. Aviva manufactures this antibody so we can offer the best price. Please contact us to request pricing information.

All of Aviva’s products are guaranteed for the applications and experimental sample types mentioned in the datasheet below. Are you curious if this product will work for you? Please contact us at techsupport@avivasysbio.com

Product Protocols: SLC12A1 antibody tested by IHC with human kidney (ARP41388)

Aviva Systems Biology is the original manufacturer of this SLC12A1 antibody.

Click here to view the SLC12A1 antibody Immunohistochemistry (IHC) protocol

Product Datasheet Link: SLC12A1 antibody (ARP41388)

IHC Information:

Rabbit Anti-SLC12A1 Antibody
Catalog Number: ARP41388
Paraffin Embedded Tissue: Human Kidney
Cellular Data: Epithelial cells of renal tubule
Antibody Concentration: 4.0-8.0 ug/ml
Magnification: 400X

IHC Image:

 
X
Ask a Question