- Description of Target:
- The product encoded by this gene is a serine proteinase inhibitor which rapidly inhibits thrombin in the presence of dermatan sulfate or heparin. The gene contains five exons and four introns. This protein shares homology with antithrombin III and other m
- Gene Symbol:
- SERPIND1
- Official Gene Full Name:
- Serpin peptidase inhibitor, clade D (heparin cofactor), member 1
- Alias Symbols:
- D22S673; HC2; HCF2; HCII; HLS2; LS2
- Tissue Tool:
- Find tissues and cell lines supported to express SERPIND1.
- Protein Accession# :
- NP_000176
- Nucleotide Accession#:
- NM_000185
- Swissprot Id:
- P05546
- Host:
- Rabbit
- Clonality:
- Polyclonal
- Protein Size (# AA):
- 499
- Molecular Weight:
- 55kDa
- Application:
- WB
- Immunogen:
- The immunogen for anti-SERPIND1 antibody: synthetic peptide directed towards the middle region of human SERPIND1
- Product Format:
- Lyophilized powder
- Purification:
- Affinity Purified
- Complete computational species homology data:
- SERPIND1 antibody - middle region (ARP41368_P050)
- Predicted Homology Based on Immunogen Sequence:
- Dog: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Guinea pig: 92%; Bovine: 85%; Chicken: 85%
- Datasheets / Downloads:
- Printable datasheet for
anti-SERPIND1 antibody
- ARP41368_P050 - Peptide Sequence:
- Synthetic peptide located within the following region: VSMMQTKGNFLAANDQELDCDILQLEYVGGISMLIVVPHKMSGMKTLEAQ
- Blocking Peptide:
- For anti-SERPIND1 antibody is Catalog # AAP41368 (Previous Catalog # AAPP24107)
- Key Reference:
- Rahgozar,S., (2008) Arthritis Rheum. 58 (4), 1146-1155
- Reconstitution and Storage:
- Add 50 μl of distilled water. Final anti-SERPIND1 antibody concentration is 1 mg/ml in PBS buffer. For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.
Product Protocols: SERPIND1 antibody tested with Human Thp-1 Cells (ARP41368_P050)
Aviva Systems Biology is the original manufacturer of this SERPIND1 antibody (ARP41368_P050)
Click here to view the SERPIND1 antibody Western Blot Protocol
Product Datasheet Link: SERPIND1 antibody (ARP41368_P050)
WB Suggested Anti-SERPIND1 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: THP-1
Western Blot image: 
Description of Target: The product encoded by this gene is a serine proteinase inhibitor which rapidly inhibits thrombin in the presence of dermatan sulfate or heparin. The gene contains five exons and four introns. This protein shares homology with antithrombin III and other m
Questions pertaining to this data can be directed to techsupport@avivasysbio.com
Aviva Systems Biology’s SERPIND1 antibody (ARP41368_P050) has been tested using other cell lysates and tissues. To obtain more data about this antibody please email us at info@avivasysbio.com.
To order by phone call us at (888) 880-0001, fax us at (858) 552-6975 or send an email to info@avivasysbio.com. Aviva manufactures this antibody so we can offer the best price. Please contact us to request pricing information.
All of Aviva’s products are guaranteed for the applications and experimental sample types mentioned in the datasheet below. Are you curious if this product will work for you? Please contact us at techsupport@avivasysbio.com
- Protocol:
- Tips Information:
See our General FAQ page.
TO ORDER：
Tel:(888) 880-0001
Fax:(858) 552-6975
